KEGG   Ailuropoda melanoleuca (giant panda): 100480586
Entry
100480586         CDS       T01329                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X2
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00562  Inositol phosphate metabolism
aml01100  Metabolic pathways
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04062  Chemokine signaling pathway
aml04064  NF-kappa B signaling pathway
aml04066  HIF-1 signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04072  Phospholipase D signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04613  Neutrophil extracellular trap formation
aml04650  Natural killer cell mediated cytotoxicity
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04750  Inflammatory mediator regulation of TRP channels
aml04919  Thyroid hormone signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05012  Parkinson disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05135  Yersinia infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05223  Non-small cell lung cancer
aml05225  Hepatocellular carcinoma
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
aml_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100480586 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100480586 (PLCG1)
   04014 Ras signaling pathway
    100480586 (PLCG1)
   04015 Rap1 signaling pathway
    100480586 (PLCG1)
   04370 VEGF signaling pathway
    100480586 (PLCG1)
   04064 NF-kappa B signaling pathway
    100480586 (PLCG1)
   04066 HIF-1 signaling pathway
    100480586 (PLCG1)
   04020 Calcium signaling pathway
    100480586 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100480586 (PLCG1)
   04072 Phospholipase D signaling pathway
    100480586 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100480586 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    100480586 (PLCG1)
   04660 T cell receptor signaling pathway
    100480586 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100480586 (PLCG1)
   04659 Th17 cell differentiation
    100480586 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100480586 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100480586 (PLCG1)
   04670 Leukocyte transendothelial migration
    100480586 (PLCG1)
   04062 Chemokine signaling pathway
    100480586 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100480586 (PLCG1)
   04919 Thyroid hormone signaling pathway
    100480586 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100480586 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100480586 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    100480586 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480586 (PLCG1)
   05206 MicroRNAs in cancer
    100480586 (PLCG1)
   05205 Proteoglycans in cancer
    100480586 (PLCG1)
   05231 Choline metabolism in cancer
    100480586 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100480586 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100480586 (PLCG1)
   05214 Glioma
    100480586 (PLCG1)
   05223 Non-small cell lung cancer
    100480586 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100480586 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    100480586 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100480586 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100480586 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100480586 (PLCG1)
   05171 Coronavirus disease - COVID-19
    100480586 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100480586 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100480586 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100480586 (PLCG1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100480586 (PLCG1)
Membrane trafficking [BR:aml04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100480586 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100480586 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD PH_9 EF-hand_6
Other DBs
NCBI-GeneID: 100480586
NCBI-ProteinID: XP_019654464
Ensembl: ENSAMEG00000009575
LinkDB
Position
13
AA seq 1255 aa
MTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQ
EDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIE
RWLRKQFYSLDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFA
QLYRSLMYSAQKTMDLPFLEASALRAGERPELCRVSLPEFQQFLLEYQGELWAVDRLQVH
EFMLSFLRDPLREIEEPYFSLDEFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSS
HNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVL
HTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQ
LKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTS
SKIYYSEETSSDQGNEDEEEPKEASGSTELHSSEKWFHGKLGAGRDGRHIAERLLTEYCI
ETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGAPKFFLTDNLVFDSLYD
LITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVR
KRNEPNSYAISFRAEGKIKHCRVQQEGQTVTLGNSEFDSLVDLISYYEKHPLYRKMKLRY
PINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTK
SAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVSPASLEPEREHLDENSPLGDLLRG
VLDVPACQIAIRPEGKNNRLFVFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTAD
ARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNK
AKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALF
MAGGHCGYVLQPSTMRDEAFDPFDKSSLRGLEPYAICIEVLGARHLPKNGRGIVCPFVEI
EVAGAEYDSIKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLA
QATFPVKGLKTGYRAVPLKNNYSEDLELASLLVKIDVFPAKENGDLSPFSMSLRERGSDT
SGQLFHGRAREGSFEARYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3768 nt   +upstreamnt  +downstreamnt
atgactttgttctactccaagaagtcgcagcggccggagcggaagaccttccaggtcaag
ctggagacgcggcagatcacgtggagccgtggcgccgacaagatcgagggggccattgac
attcgcgaaatcaaggagatccgcccagggaagacctcacgggattttgatcgctaccaa
gaggaccctgctttccgaccagaccagtcacactgctttgtcatcctgtatgggatggaa
ttccgcctgaagaccctgagcctgcaagctacgtctgaggatgaagtgaacatgtggatc
aagggtttaacatggttgatggaggatacattgcaggcagccacgcctctgcagatcgag
aggtggctgcggaagcagttctactcgctggatcggaatcgtgaggatcgtatatcagcc
aaggacctgaagaacatgctgtcccaggtcaactaccgggtccccaacatgcgcttcctc
cgagagcgtctgacggacctggagcagcgcagcagtgacatcacctacgggcagtttgct
cagctgtaccgcagcctgatgtacagcgcccagaagacgatggacctccccttcttggaa
gccagtgccctgagggctggggagcggccggagctctgtcgcgtgtcccttcctgagttc
cagcagttcctcctcgagtaccagggggagctgtgggctgttgaccggcttcaggtgcat
gagttcatgctcagcttccttcgagaccccttgcgagaaattgaagagccatacttctcc
ctggatgagtttgtcaccttcctgttctccaaagagaacagtgtgtggaactcgcagctg
gatgcagtgtgcccggataccatgaacaaccctctctcccactactggatctcttcctcc
cacaacacgtacctgaccggggaccagttctccagcgagtcctccctagaagcctacgct
cgctgcctgcggatgggctgtcgctgcattgagttggactgctgggacggcccagatggg
atgccagtcatttaccatggacacacccttaccaccaagatcaagttctcggatgttctg
cacaccatcaaggagcatgcctttgtggcctcagagtacccggtcatcctgtccatcgag
gaccactgcagcattgctcagcagagaaacatggcacagtatttcaagaaggtgcttggg
gacacactccttaccaagcccgtggacatcgctgccgacgggctcccctcacccaaccag
ctcaagaggaagatcctcatcaagcacaagaagctggcggagggcagtgcctacgaagag
gtgcctacgtcggtgatgtactccgagaatgatatcagcaactccatcaagaatggcatc
ctctacctggaggaccccgtgaaccatgagtggtacccccactatttcgttctgaccagc
agcaagatctactactctgaggagaccagcagtgaccagggcaatgaggatgaggaggag
cccaaggaggccagtggcagcacagagctgcactccagtgagaagtggttccatgggaag
ctcggggcgggacgggacggacggcacatcgctgagcgcctgctcaccgagtactgcatc
gagaccggggcccctgatggctccttcctcgtgcgggagagcgagacctttgtgggcgac
tacaccctctctttctggaggaacgggaaagtccagcactgccggatccactcccggcag
gacgctggggcccccaagttcttcttgacagacaacttggtctttgactcgctctatgac
ctcatcacgcactaccagcaggtgcccctgcgctgcaacgaatttgagatgcgcctctcc
gagcctgtcccgcagaccaatgcccacgagagcaaagagtggtaccacgccagcctgacc
agagctcaggccgagcacatgctgatgcgtgtcccccgggatggggccttcctggtgaga
aaacggaatgagcccaactcctacgccatctccttccgggccgagggcaagatcaagcat
tgccgcgtccagcaggagggccagacggtgacgctgggcaactcggagttcgacagcctc
gtggacctcatcagctactatgagaagcacccgctgtaccgcaagatgaagctgcgctac
cccatcaacgaggaggcgctagagaagatcggcaccgctgagcctgactatggagccttg
tatgagggacgcaaccctggcttctacgtagaggcaaatcctatgccgactttcaagtgt
gcggtcaaagccctctttgactacaaggcccagagggaggacgagctgacgttcacaaag
agcgccatcatccagaacgtggagaagcaagaaggcggctggtggcggggggactacggg
gggaagaagcagctgtggttcccgtcaaactacgtggaggagatggtcagccctgcatcc
ctggagccggagagggagcacttggacgagaacagccccctgggggacttgctccggggg
gtcttggatgtgccggcttgtcagattgccatccgtcctgagggcaagaacaaccggctc
ttcgtcttctccatcagcatggcttcagtggcgcactggtccttggacgtcgccgctgac
tcacaggaggagctgcaggactgggtgaagaagatccgagaagtggcccagacggcagac
gccaggctcacagaggggaagatgatggagcgcagaaagaagattgccctagagctctcc
gagctggttgtctactgtcggcctgttcccttcgatgaagagaagattggcacagaacgt
gcctgctaccgggacatgtcgtcctttccggaaaccaaggctgagaaatacgtgaacaag
gccaaaggcaagaagttcctccagtacaaccgtctgcagctctcccgcatctaccccaag
ggccagcggctagactcctccaattacgaccccttgcccatgtggatctgcggcagtcag
ctggtggccctcaacttccagacgccagacaagcctatgcagatgaaccaggcgctcttc
atggccggtggccactgcggctacgtgctgcagcccagcaccatgcgggatgaggccttt
gacccttttgacaagagcagcctccgaggcctagagccatatgccatctgcattgaggtg
ctgggggcccggcacctgccaaagaatggccgaggcatcgtgtgtccttttgtggagatt
gaggtggccggagcggagtatgacagcatcaagcagaagacagagtttgtggtggacaat
ggactgaaccctgtgtggcctgccaagcccttccacttccagatcagtaacccggaattt
gcctttctgcgctttgtggtgtatgaggaagacatgtttagtgaccagaacttcttggct
caggctaccttcccggtgaaaggcctgaagacaggatacagagccgtgcctttgaagaac
aactacagtgaggacttggagctggcctccctgctcgtcaagatcgatgttttccctgcc
aaggaaaacggggacctcagtcccttcagtatgtctctgcgggagcggggctccgatacc
tcaggccagctgtttcatggccgggcccgggaaggttcctttgaagcccgctaccagcag
ccatttgaggactttcgtatctcccaggagcacctggcagaccattttgacagtcgggaa
cggagggccccacgaaggactcgggtcaacggagacaaccgcctctag

KEGG   Ailuropoda melanoleuca (giant panda): 100481994
Entry
100481994         CDS       T01329                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 isoform X1
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00562  Inositol phosphate metabolism
aml01100  Metabolic pathways
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04020  Calcium signaling pathway
aml04062  Chemokine signaling pathway
aml04064  NF-kappa B signaling pathway
aml04066  HIF-1 signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04072  Phospholipase D signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04380  Osteoclast differentiation
aml04611  Platelet activation
aml04613  Neutrophil extracellular trap formation
aml04625  C-type lectin receptor signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml04662  B cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04670  Leukocyte transendothelial migration
aml04722  Neurotrophin signaling pathway
aml04750  Inflammatory mediator regulation of TRP channels
aml04919  Thyroid hormone signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05223  Non-small cell lung cancer
aml05225  Hepatocellular carcinoma
Module
aml_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100481994 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100481994 (PLCG2)
   04014 Ras signaling pathway
    100481994 (PLCG2)
   04370 VEGF signaling pathway
    100481994 (PLCG2)
   04064 NF-kappa B signaling pathway
    100481994 (PLCG2)
   04066 HIF-1 signaling pathway
    100481994 (PLCG2)
   04020 Calcium signaling pathway
    100481994 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100481994 (PLCG2)
   04072 Phospholipase D signaling pathway
    100481994 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100481994 (PLCG2)
   04613 Neutrophil extracellular trap formation
    100481994 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    100481994 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100481994 (PLCG2)
   04662 B cell receptor signaling pathway
    100481994 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100481994 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100481994 (PLCG2)
   04670 Leukocyte transendothelial migration
    100481994 (PLCG2)
   04062 Chemokine signaling pathway
    100481994 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100481994 (PLCG2)
   04919 Thyroid hormone signaling pathway
    100481994 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100481994 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100481994 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    100481994 (PLCG2)
   04380 Osteoclast differentiation
    100481994 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100481994 (PLCG2)
   05206 MicroRNAs in cancer
    100481994 (PLCG2)
   05205 Proteoglycans in cancer
    100481994 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100481994 (PLCG2)
   05214 Glioma
    100481994 (PLCG2)
   05223 Non-small cell lung cancer
    100481994 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100481994 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100481994 (PLCG2)
   05171 Coronavirus disease - COVID-19
    100481994 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100481994 (PLCG2)
   05169 Epstein-Barr virus infection
    100481994 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100481994 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100481994 (PLCG2)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100481994 (PLCG2)
Membrane trafficking [BR:aml04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100481994 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100481994 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH PH_12 SH3_2 PH_14
Other DBs
NCBI-GeneID: 100481994
NCBI-ProteinID: XP_034495338
Ensembl: ENSAMEG00000014051
LinkDB
Position
12
AA seq 1198 aa
MEIKEIRPGKNSKDFERAKAVRQKEDCCFTVLYGTQFVLSTLSLAADSKEDATKWLSGLK
ILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVNSAKFLKDKF
VEIGAHKDELSFEQFHLFYKNLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLHDFQ
RFLLHEQQELWAQDLTKVRERMTKFIHDTVRETAEPFLFVDEFLTYLFSRENSIWDEKYD
VVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYVRCLRMGCRCIELDCWDGPDGK
PIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARVFKEVFGD
QLLMKPTEASADQLPSPSQLRERIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSI
DQKWTRHYCAIADAKLSFSDDIEQTAEEELPQDIPPTELHFGEEWFHKKVEKRASAEKLL
QEYCAETGGKDGTFLVRESKTFPNDYTLSFWRSGRVQHCRIRSTMEGGTMKYFLTDNITF
TSIYALIQHYRETHLRCTEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDMLMRVPRDG
AFLIRRREGTDSYAITFRARGKVKHCRIHRDGRHFVLGTSAYFESLVELVSYYEKHALYR
KMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDYKAKRSDE
LSFCRGALIHNVSKEPWGWWKGDYGTRIQQYFPSNYVEDISTFDGEEMEKQIIEDNPLGS
LCRGILDLNTYNVVKAPQGKNQKQFVFILEPKKQGDPPVEFATDKVEELFEWFQSIREIT
WKMDTKENNMKYWEKNQSIAIELSDLVIYCKPTSKTKDNLENPDFREIRSFVETKADSVV
RQKPIDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKYMQMNHAL
FSLNGRTGYVLQPESMRSEKYDPIPPESQRKILMTLSVKVLGARHLPKLGRSIACPFVEV
EICGAEYDNNKFKTTVVNDNGLSPVWAATQEKVTFEIYDPSLAFLRFVVYEEDMFSDPNF
LAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMQPVLESEEELYSSCRQLRRRQ
EELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSNSRFYS
NT seq 3597 nt   +upstreamnt  +downstreamnt
atggaaatcaaggaaatccgcccagggaagaactccaaggattttgagcgtgccaaagct
gtccgccagaaggaagactgctgctttaccgtcctgtacggcacccagtttgttctcagc
acgctcagtttggcagccgactccaaagaagatgcgactaagtggctgtctggcttgaaa
atcttacaccaggaagcgatgagcgcctccacacccaccattattgagagttggctgaga
aagcagatttattcagtggatcaaaccagaagaaacagcatcagcctccgagagttgaaa
accatcttacccctggtcaacttcaaagtgaacagtgccaagttcctcaaagataagttt
gtggaaatcggcgcgcacaaagatgaactcagcttcgagcagttccacctgttctacaaa
aaccttatgtttgagcaacaaaagtcgattcttgacgaattcaaaaaagattcttccgtg
ttcatcttgggcaacaccgaccggccggatgcctccgctgtttacctgcacgacttccag
cgctttctcttacacgagcagcaggagctttgggctcaggatctgaccaaagtccgtgag
cggatgactaagtttatccacgacaccgtgagggaaactgctgagcccttcttatttgtc
gatgagttcctcacatacctgttctcgcgggagaacagcatctgggatgagaagtacgac
gtggtggacatgcaggacatgaacaaccccttgtcgcattactggatctcctcttcgcat
aacacgtacctcaccggtgaccaactgcggagcgagtcatctacggaagcgtacgtccgc
tgcctgcggatgggctgtcgctgcattgagctggactgctgggacgggcctgatgggaag
cccatcatctaccacggctggacacggaccaccaagatcaagtttgatgatgtcgtgcag
gccatcaaagaccatgcatttgtcacttcaagcttcccggtgatcctgtccatcgaggag
cactgttgcgtggaacagcagcgccacatggccagggtgttcaaggaggtgtttggcgac
cagctgctgatgaagcccacggaggccagtgctgaccagctgccctcgcccagccagctg
cgggagaggataatcatcaagcataagaagctgggcccccgaggtgacgtggatgtcaac
atggaggataagaaagatgagcacaaacaacagggtgaactgtacatgtgggattccatc
gaccagaagtggactcggcactactgtgccatcgctgatgccaagctgtcgttcagcgat
gacattgaacagactgcagaagaggagctgccccaggatataccccctacggagctgcac
tttggggaggagtggttccacaagaaggtggagaagagggcaagtgccgagaagctgctg
caggaatactgtgcggagacggggggcaaggatgggaccttcctggtgcgggagagcaag
accttccccaacgactacactctgtccttctggcggtccggccgggtccagcactgccgg
atccgttccaccatggagggcgggaccatgaagtacttcctgactgacaacatcacgttc
accagcatctatgccctcatccagcactaccgcgagacgcacctgcgctgcacggagttc
gagctccggctcaccgaccctgtgcccaaccccaacccccacgagtcaaagccgtggtac
tatgacgggctgagccgcggggaagcggaggacatgctcatgagggttccccgggacggc
gccttcctgatccggaggcgggagggcaccgactcctacgccatcaccttcagggccagg
ggcaaggtaaagcactgtcgcattcaccgggacggccggcactttgtgctggggacctcg
gcctacttcgagagcctcgtggagctcgtcagctactacgagaagcatgcgctctaccgg
aagatgcggctgcgctaccccgtgacgccggagctcctggagcgctacaatatggaaaga
gacataaactccctctatgacgtcagcaggatgtatgtggatcccagcgaaatcaatcct
tccatgcctcagagaaccgtgaaagctctgtatgactacaaagccaagcgaagtgatgag
ctgagcttctgccgtggggccctcattcacaacgtctccaaggaaccctggggctggtgg
aaaggagactatgggaccagaatccagcagtacttcccatccaattatgtcgaggacatt
tcaacattcgacggggaggagatggagaagcagattattgaagacaatcccttagggtct
ctttgtaggggaatattggatctcaacacctataacgtcgtgaaagccccccaggggaaa
aaccagaaacagttcgtgtttatcctggagcccaagaagcaaggcgaccccccagtcgag
tttgccacggacaaggtggaggagctctttgagtggttccagagcatccgggagatcacc
tggaagatggacaccaaggagaacaacatgaaatactgggagaagaaccagtccatcgcc
attgagctctcggacctggtgatttactgcaagccgaccagcaagaccaaggacaatcta
gaaaaccccgacttccgagaaatccgctcctttgtggagacgaaggcggacagtgtcgtc
aggcagaaacccattgacctcctgaagtacaatcagaagggcctgacccgtgtttaccca
aagggacagagggtggactcctccaactacgacccctttcgcctctggctgtgtggctcc
cagatggtggcactcaacttccagacgccagacaagtacatgcagatgaatcacgccttg
ttctcactcaacgggcggacgggctacgtcctccagcctgagagcatgaggtccgagaag
tacgaccccataccaccggagtcccagaggaagatcctgatgactctgtcagtcaaggtt
cttggggctcgccatctccccaagcttggacgaagtattgcgtgtccctttgtggaggtg
gaaatctgtggagctgaatatgacaacaacaagtttaagacaacagttgtgaatgacaat
ggcctaagtcctgtttgggctgcaacacaggagaaagtgacctttgaaatttatgacccc
agcctggcatttctgcgttttgtggtctacgaggaagatatgttcagtgatcccaatttc
ctggcccacgccacttaccccatcaaaggaatcaaatcaggattcagatctgttcctctg
aagaacgggtacagcgaagacatcgagctggcttccctcctggttttctgtgagatgcag
ccagtcctggagagcgaagaggagctgtattcgtcctgccgccagctgcgacggcggcag
gaagaactgaacaaccagctcttcctgtacgacacgcaccagaacttacgtaacgccaac
cgggatgccctcgtgaaagagttcaacgtcaatgagaaccagctccagctctatcaggag
aagtgcaaccggaggttgagagagaagagagtgagcaacagcaggttttactcctag

DBGET integrated database retrieval system