KEGG   Ailuropoda melanoleuca (giant panda): 100480862
Entry
100480862         CDS       T01329                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2 precursor
  KO
K05429  interleukin 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04061  Viral protein interaction with cytokine and cytokine receptor
aml04151  PI3K-Akt signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04672  Intestinal immune network for IgA production
aml04940  Type I diabetes mellitus
aml05135  Yersinia infection
aml05142  Chagas disease
aml05162  Measles
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05320  Autoimmune thyroid disease
aml05321  Inflammatory bowel disease
aml05330  Allograft rejection
aml05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100480862 (IL2)
   04151 PI3K-Akt signaling pathway
    100480862 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100480862 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100480862 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100480862 (IL2)
   04660 T cell receptor signaling pathway
    100480862 (IL2)
   04658 Th1 and Th2 cell differentiation
    100480862 (IL2)
   04659 Th17 cell differentiation
    100480862 (IL2)
   04672 Intestinal immune network for IgA production
    100480862 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480862 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100480862 (IL2)
   05321 Inflammatory bowel disease
    100480862 (IL2)
   05330 Allograft rejection
    100480862 (IL2)
   05332 Graft-versus-host disease
    100480862 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100480862 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100480862 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100480862 (IL2)
   05162 Measles
    100480862 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100480862 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100480862 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100480862 (IL2)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Interleukins
   100480862 (IL2)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Haparin
  Cytokines
   100480862 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 100480862
NCBI-ProteinID: NP_001291800
Ensembl: ENSAMEG00000005901
UniProt: H2DL90
LinkDB
AA seq 155 aa
MYKMQLLYCIALTLVLVANSAPTPSSPTKETQQQLEQLLLDLRLLLNGVNNYENPKLSRM
LTFKFYMPKKATELKHLQCLAEELKLLEEVLYLDQSKNLHLTDIKELMSNINVTLLKLKG
SEASFKCEYDDETVTITEFLNKWITFCQSIFSTLT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaaaatgcaactcttgtattgcatcgcactgactcttgtactcgtcgcaaacagt
gcacctactccttcaagccctacgaaggaaacacagcaacagctggagcaattgctgctg
gatttacggttgctcttgaatggagttaataattatgagaaccccaaactctccaggatg
ctcacgtttaaattctacatgcccaagaaggccacagaattgaaacatcttcaatgtcta
gcagaagaactcaaacttctggaggaagtgctatatttagatcaaagcaaaaaccttcac
ttgacagacatcaaggaattaatgagcaatatcaatgtaacacttctgaaactaaaggga
tcagaagcaagtttcaaatgtgaatatgatgacgagacagtaaccatcacagaatttctg
aacaaatggattactttttgtcaaagcatcttctcaacactgacttaa

DBGET integrated database retrieval system