KEGG   Ailuropoda melanoleuca (giant panda): 100481236
Entry
100481236         CDS       T01329                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04218  Cellular senescence
aml04530  Tight junction
aml04660  T cell receptor signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04934  Cushing syndrome
aml05160  Hepatitis C
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05212  Pancreatic cancer
aml05214  Glioma
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100481236 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100481236 (CDK4)
   04115 p53 signaling pathway
    100481236 (CDK4)
   04218 Cellular senescence
    100481236 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100481236 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100481236 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100481236 (CDK4)
   05203 Viral carcinogenesis
    100481236 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100481236 (CDK4)
   05225 Hepatocellular carcinoma
    100481236 (CDK4)
   05214 Glioma
    100481236 (CDK4)
   05220 Chronic myeloid leukemia
    100481236 (CDK4)
   05218 Melanoma
    100481236 (CDK4)
   05219 Bladder cancer
    100481236 (CDK4)
   05224 Breast cancer
    100481236 (CDK4)
   05222 Small cell lung cancer
    100481236 (CDK4)
   05223 Non-small cell lung cancer
    100481236 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100481236 (CDK4)
   04934 Cushing syndrome
    100481236 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100481236 (CDK4)
   05160 Hepatitis C
    100481236 (CDK4)
   05164 Influenza A
    100481236 (CDK4)
   05162 Measles
    100481236 (CDK4)
   05163 Human cytomegalovirus infection
    100481236 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100481236 (CDK4)
   05169 Epstein-Barr virus infection
    100481236 (CDK4)
   05165 Human papillomavirus infection
    100481236 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100481236 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100481236 (CDK4)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100481236 (CDK4)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100481236 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 100481236
NCBI-ProteinID: XP_002916069
Ensembl: ENSAMEG00000005351
UniProt: D2H394
LinkDB
Position
15
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLMLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctactcctcgatatgagccagtggctgagattggtgttggtgcctatggaacggta
tacaaggcccgtgatcctcacagcggccacttcgtggccctcaagagcgtaagagtccct
aatggaggaggtgctggagggggccttcccatcagcacagttcgtgaggtggccttactg
cggcggctggaggcttttgagcatcccaacgtcgtccggctgatggatgtctgtgccacc
gcccgaactgaccgggagaccaaagtgactctggtgtttgagcacgtggaccaagacctg
aggacatatctggacaaggcacccccaccaggcttgccagtggagaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaactgcatcgttcaccgagac
ctgaagccagagaacattctcgtgaccagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacgcctgtggttgttacactctggtat
cgtgctccagaagttcttctgcagtctacatacgcaacacccgtggacatgtggagtgtt
ggctgtatcttcgcagagatgtttcgtcgaaagcccctcttctgtggaaactctgaagct
gaccagttaggcaaaatcttcgacctgatcgggctgcccccagaggatgactggccccga
gatgtgtctctgccccgaggagccttttcccccagagggccccgcccagtgcagtcagtg
gtacctgagttggaggagtctggagcacaactgatgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system