KEGG   Ailuropoda melanoleuca (giant panda): 100481489
Entry
100481489         CDS       T01329                                 

Gene name
DLG1
Definition
(RefSeq) disks large homolog 1 isoform X7
  KO
K12076  disks large protein 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04390  Hippo signaling pathway
aml04530  Tight junction
aml04660  T cell receptor signaling pathway
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100481489 (DLG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100481489 (DLG1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100481489 (DLG1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100481489 (DLG1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100481489 (DLG1)
   05165 Human papillomavirus infection
    100481489 (DLG1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100481489 (DLG1)
SSDB
Motif
Pfam: Guanylate_kin PDZ PDZ_6 PDZ_assoc PDZ_2 MAGUK_N_PEST SH3_1 SH3_2 SH3_9 DUF1638
Other DBs
NCBI-GeneID: 100481489
NCBI-ProteinID: XP_011219990
Ensembl: ENSAMEG00000003539
LinkDB
Position
1
AA seq 844 aa
MNYIFGNNTLLYSRASRGGNTSSSHGSVGPKQKHWAKKGSSDELQAEPEPSRWQQIVAFF
TRRHSFIDCISVATSSTQPTEAVPPSSPTVPVIPVLPVPAENTVILPTIPQANPPPVLVN
TDSLETSTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIIAGGA
AAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLI
KGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVT
HEEAVTALKNTSDFVYLKVAKPTSMYMNDGYVPPDITNSSSQPIDNHVSPSSYLGHTPAS
PARYSPVSKAMLGDDELTREPRKVILHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLS
GELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQ
MMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEW
WQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGQSFNDKRKKNLFSR
KFPFYKNKDQSEQETSDADQHITSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIIL
GPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIE
AGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIME
MNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPA
KEKL
NT seq 2535 nt   +upstreamnt  +downstreamnt
atgaattacattttcgggaacaacacacttctatactctcgcgccagtcgaggaggcaat
actagctctagccatggctcagtaggcccaaagcagaaacattgggcaaaaaagggttca
tcagatgaactgcaagctgagccagaaccttcacgctggcagcagatagttgcatttttc
actcgaagacacagctttattgactgcatctcggtagccaccagctccacccagccaaca
gaagctgtacctccctcttctcccactgtccctgtgatccctgtcctgccagtccctgca
gagaatactgtcatcctacccaccataccacaggcaaatcctcctccagtactggtcaac
acagatagcttggaaacgtcaacttatgttaacggcactgatgcagattatgaatatgaa
gaaatcacacttgaaaggggaaattcagggcttggtttcagcattgcaggaggtacagac
aacccacacattggagatgactcaagtattttcattaccaaaattattgcagggggagca
gctgcccaagatggaagattacgggtcaatgactgtatattgcgagtaaatgaagtagat
gttcgtgatgtgacacatagcaaagcagttgaagcattgaaagaagcagggtctatcgta
cgcttgtacgtaaaaagacggaaaccggtatcagaaaaaataatggaaataaagctcatt
aaaggtcctaaaggtcttgggttcagcattgctggaggtgttggaaatcaacatattcct
ggggataatagcatctatgtaaccaaaataattgaaggaggtgcagcacataaagatggt
aaacttcagattggagataaacttttagcagtcaatagtgtgtgtttggaagaagttact
catgaagaagcagtaactgccttaaagaacacgtctgattttgtttatttgaaagtggca
aaacccacaagtatgtatatgaatgatggctatgtaccacctgatatcaccaactcttct
tctcaacctattgataaccatgttagcccatcttcctacttgggccatacgccagcatca
ccagccagatactcacctgtttcaaaagcaatgcttggagatgatgaacttacgagggaa
cctagaaaagttattcttcatcgtggctcaacaggccttggtttcaacattgtaggaggt
gaagatggagaaggaatatttatttcctttattttggctggaggacctgctgatcttagt
ggagagctcagaaaaggagatcgtattatatcggtaaacagtgttgacctcagagctgcc
agccatgagcaagcagcagccgctttgaaaaatgctggccaagctgtcacgattgttgcg
cagtatcggcctgaagaatacagtcgttttgaagccaaaatacatgacttacgggagcag
atgatgaatagtagcattagttcaggatcaggttctcttcgaactagccagaagcgatcc
ctctatgtcagagccctttttgattatgacaaaactaaagacagtggccttcccagtcaa
gggctgaacttcaaatttggagatatcctccatgttattaatgcttctgatgatgaatgg
tggcaagccaggcaggttacaccagatggggagagtgacgaagttggagtaattcccagt
aaacgcagagttgagaagaaagaacgagcccggttaaaaacagtgaaatttaattctaaa
acaagaggagataaagggcagtcattcaatgacaagcgtaaaaagaacctcttttcccga
aaattccccttctacaagaacaaggaccagagtgagcaggaaacaagtgatgctgaccag
catataacttctaatgccagcgatagtgaaagtagttaccgtggtcaagaagaatatgtc
ttatcttatgagccagtgaatcaacaagaagttaattatactcgaccagtgatcatattg
ggacctatgaaagacaggataaatgatgacttgatctcagaatttcctgacaaatttgga
tcatgtgttcctcataccactagaccaaaacgagactatgaggtagatggaagagattat
cattttgtgacttcaagagagcagatggaaaaagatattcaagaacataaatttattgaa
gctggccagtataacaaccatctgtatggaacaagtgttcagtctgtgcgggaagtagca
gaaaagggcaaacactgtatcctcgatgtatctggaaatgccataaagagattacagatt
gcacaactttacccaatctccatttttattaaacccaaatccatggaaaatatcatggaa
atgaataagcgtctaacagaagaacaagccagaaagacatttgagagagccatgaaactg
gaacaagaatttactgaacatttcacagctattgtacagggagatacgctggaagacatt
tataaccaagtgaagcagatcatagaagaacagtctggtccttacatctgggttccagct
aaagaaaagttatga

DBGET integrated database retrieval system