KEGG   Ailuropoda melanoleuca (giant panda): 100481494
Entry
100481494         CDS       T01329                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1 isoform X2
  KO
K04375  ETS domain-containing protein Elk-1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04510  Focal adhesion
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04921  Oxytocin signaling pathway
aml05140  Leishmaniasis
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05213  Endometrial cancer
aml05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100481494 (ELK1)
   04012 ErbB signaling pathway
    100481494 (ELK1)
   04014 Ras signaling pathway
    100481494 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100481494 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100481494 (ELK1)
   04912 GnRH signaling pathway
    100481494 (ELK1)
   04921 Oxytocin signaling pathway
    100481494 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100481494 (ELK1)
   05205 Proteoglycans in cancer
    100481494 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100481494 (ELK1)
   05213 Endometrial cancer
    100481494 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100481494 (ELK1)
   05161 Hepatitis B
    100481494 (ELK1)
   05163 Human cytomegalovirus infection
    100481494 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100481494 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100481494 (ELK1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100481494 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 100481494
NCBI-ProteinID: XP_019653677
Ensembl: ENSAMEG00000012855
LinkDB
Position
X
AA seq 435 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVARCSTEDCPPQPEVSITSTVANVAPTAVH
AVPGDTASGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPPPHPRPA
SVLPNTAPSGAAVPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEVQNPKSEELNVEP
GLGRPLPPEVKVDRPKEELEATVGGEAGFVQEAAKAGPEVPPAEGAPARLPAVVMETAAP
GGGLAASTASSTEIAQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGTGSGLQAPGPALT
PSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVD
GLSTPVVLSPGPQKP
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggacccctctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaggcaat
ggccacatcatctcttggacctcacgggatggcggtgagttcaagctggtggatgctgag
gaggtggcccggctgtgggggctgcgtaagaacaagaccaacatgaattacgacaagctc
agccgggccctgcggtactactatgacaagaacattatccgcaaagtgagcggccagaag
ttcgtctacaagtttgtgtcctaccccgaagtcgcgaggtgctccactgaggactgcccg
ccccagcccgaggtgtctatcacctctactgtggcaaatgtggcccctactgctgtacat
gctgtccccggggacactgcctctgggaaaccaggcacaccgaagggagcaggaatggca
ggcccgggtggcttggcacgcagcagccggaacgagtacatgcgctcaggcctctattcc
accttcaccatccagtccctgcagccacagccacagccgccccctcatcctcggcctgcc
tcagtgctccccaacaccgccccatcgggagcagcagtgcccccatctgggagcaggagc
accagtccaagccccttggaggcctgcctggaggctgaggaggctggcctgcctctgcag
gtcatcctgaccccacccgaggtccagaaccctaaatcagaagagctgaatgtggagccc
gggttgggcaggccactgcccccagaagtgaaagtggacaggcccaaggaagagttggaa
gccacagtcggtggggaggcggggtttgtgcaggaagccgctaaggccgggccggaagtc
cctcctgcggagggcgcgccggcccggctgcccgcggtcgtcatggagactgcagcaccg
gggggcggcctcgcggcttccactgcttccagcacagagatcgcccaaccccagaagggc
cggaagccccgggacctggagcttccactcagcccgagcctgctgggtgggccaggaccc
gaacggactccaggatcgggaaccggctccgggctgcaggcgccggggccagcgctgacc
ccgtccctgctacctacgcacacgttgaccccggtgctgctgacgcccagctcgctgccc
cccagcattcacttctggagcaccctgagtcccattgcaccccgtagcccagccaagctc
tcctttcagtttccgtccagtggcagcgcccaggtgcacatcccttccatcagcgtggat
ggcctctcaacccccgtggtgctctccccagggccccagaagccatga

DBGET integrated database retrieval system