KEGG   Ailuropoda melanoleuca (giant panda): 100481615Help
Entry
100481615         CDS       T01329                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00590  Arachidonic acid metabolism
aml01100  Metabolic pathways
aml04064  NF-kappa B signaling pathway
aml04370  VEGF signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04668  TNF signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04726  Serotonergic synapse
aml04913  Ovarian steroidogenesis
aml04921  Oxytocin signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml05140  Leishmaniasis
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05204  Chemical carcinogenesis
aml05206  MicroRNAs in cancer
aml05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100481615 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100481615 (PTGS2)
   04064 NF-kappa B signaling pathway
    100481615 (PTGS2)
   04668 TNF signaling pathway
    100481615 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100481615 (PTGS2)
   04657 IL-17 signaling pathway
    100481615 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100481615 (PTGS2)
   04913 Ovarian steroidogenesis
    100481615 (PTGS2)
   04921 Oxytocin signaling pathway
    100481615 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    100481615 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100481615 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100481615 (PTGS2)
   05206 MicroRNAs in cancer
    100481615 (PTGS2)
   05204 Chemical carcinogenesis
    100481615 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    100481615 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    100481615 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100481615 (PTGS2)
   05165 Human papillomavirus infection
    100481615 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    100481615 (PTGS2)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100481615 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF DUF658
Motif
Other DBs
NCBI-GeneID: 100481615
NCBI-ProteinID: XP_002924890
Ensembl: ENSAMEG00000015532
UniProt: G1MAL9
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAALALCRAANPCCSNPCQNQGVCMSIGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLRNAIMKYVLTSRSHLIESPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKMKY
QVIDGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLRFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFVYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYSSFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccgcgctctgctgctctgtgccgccctggcgctctgccgtgcagcaaatcct
tgctgttccaacccatgtcaaaaccaaggtgtatgtatgagcataggatttgaccagtat
aagtgtgactgcactcgaacaggattctatggcgaaaactgttcaacacctgaatttctg
acaagaataaaattattcctgaaacccactccaaatacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgagaaatgcaattatgaaa
tacgtgttgacatcgaggtcacatttgattgagagtccaccaacttacaacgtggactat
ggctataaaagctgggaagccttttctaatctctcctactataccagagctcttccccct
gtggctgatgactgtccaacacccatgggtgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaaatttcttctaagaagaaagttcattcctgatccccagggcaca
aatatgatgtttgcattctttgcccagcactttacccatcaatttttcaagacagatcat
aagcgagggccagctttcaccaaaggactgggccatggggtggacttaaaccatgtttat
ggggaaactttggatagacaacataaactgcgccttttcaaggatggaaaaatgaaatat
caggtcattgatggagaggtgtatcctcccacagtcaaagatactcaggtggagatgatc
tacccaccccatgttcccgaacacctacggtttgccgtgggccaggaagttttcgggctg
gtgcctggtctgatgatgtatgccacgatttggttgcgggaacataacagagtgtgtgat
gtgcttaaacaggagcacccagagtgggatgatgagcggctgttccagaccagcaggctc
atactgatcggagaaaccattaagattgtgattgaagactatgtacagcacttgagtggt
tatcacttcaagctgaggtttgacccggagctgcttttcaaccaacaattccagtaccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctacctgacacc
ttgcaaatagatgaccaggagtacaatttccaacagtttgtctacaacaactctatattg
ctggaacatggacttacccagtttgtggaatcattcagcaggcaaattgctggcagggtt
gccggtggtaggaatgttccagctgcagtacaacaagtagcaaaggcctcaatcgaccag
agcagacagatgaaataccagtctcttaatgagtatcgcaaacgctttcggctgaagccc
tattcatcattcgaagaacttacaggagagaaggaaatggctgcggggttagaggccctt
tatggtgatattgatgccatggagctgtatcctgccctcctggtagaaaagcctcgtcca
gatgccatctttggtgagactatggtagaaatgggagcaccattttccttgaaaggactt
atgggtaatcccatctgttcgcctgactactggaagcctagcacttttggtggagaagta
ggctttaaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgcgttcagtgttcaagacccacagcttaccaaaacagtcaccattaat
gcaagctcttcacactcgggactagacgacatcaatcccacagtccttctaaaagaacgg
tccactgaactgtag

DBGET integrated database retrieval system