Ailuropoda melanoleuca (giant panda): 100481671 Help Entry 100481671         CDS       T01329                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04061   Viral protein interaction with cytokine and cytokine receptor aml04068   FoxO signaling pathway aml04148   Efferocytosis aml04625   C-type lectin receptor signaling pathway aml04630   JAK-STAT signaling pathway aml04660   T cell receptor signaling pathway aml04672   Intestinal immune network for IgA production aml05133   Pertussis aml05135   Yersinia infection aml05140   Leishmaniasis aml05142   Chagas disease aml05143   African trypanosomiasis aml05144   Malaria aml05145   Toxoplasmosis aml05146   Amoebiasis aml05150   Staphylococcus aureus infection aml05152   Tuberculosis aml05310   Asthma aml05320   Autoimmune thyroid disease aml05321   Inflammatory bowel disease aml05322   Systemic lupus erythematosus aml05330   Allograft rejection Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100481671 (IL10)    04068 FoxO signaling pathway     100481671 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100481671 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     100481671 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100481671 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100481671 (IL10)    04660 T cell receptor signaling pathway     100481671 (IL10)    04672 Intestinal immune network for IgA production     100481671 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     100481671 (IL10)    05133 Pertussis     100481671 (IL10)    05150 Staphylococcus aureus infection     100481671 (IL10)    05152 Tuberculosis     100481671 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     100481671 (IL10)    05144 Malaria     100481671 (IL10)    05145 Toxoplasmosis     100481671 (IL10)    05140 Leishmaniasis     100481671 (IL10)    05142 Chagas disease     100481671 (IL10)    05143 African trypanosomiasis     100481671 (IL10)   09163 Immune disease    05310 Asthma     100481671 (IL10)    05322 Systemic lupus erythematosus     100481671 (IL10)    05320 Autoimmune thyroid disease     100481671 (IL10)    05321 Inflammatory bowel disease     100481671 (IL10)    05330 Allograft rejection     100481671 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100481671 (IL10)    00536 Glycosaminoglycan binding proteins [BR:aml00536]     100481671 (IL10) Cytokines and neuropeptides [BR:aml04052]  Cytokines   Interleukins    100481671 (IL10) Glycosaminoglycan binding proteins [BR:aml00536]  Heparan sulfate / Heparin   Cytokines    100481671 (IL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 IL22 ALIX_LYPXL_bnd CLZ Motif Other DBs NCBI-GeneID:  100481671 NCBI-ProteinID:  XP_002919320 Ensembl:  ENSAMEG00000017490 UniProt:  G1MGJ4 LinkDB All DBs Position 8:97093672..97098237 Genome browser AA seq 178 aa AA seqDB search MPSPAQLCCLVLLAGVGASRHHTAPSEDNCTHFPASLPHMLRELRAAFGRVKTFFQMKDK LDNILLTGSLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTLR LRLRRCHRFLPCENKSKAVEQVKSAFSKLQERGVYKAMSEFDIFINYIETYMTMRMKI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcccagcccagcgcagctgtgttgcctggtcctgctggccggggtaggagccagccga caccacactgccccgtctgaggacaactgcacccacttcccagccagcctgccccacatg ctgcgagagctccgagctgcctttggcagggtgaagactttctttcaaatgaaggacaag ctggacaacatattgttgacggggtccttgctggaggactttaagggttacctgggttgc caagccttgtcggagatgatccagttttacttggaggaggtgatgccccaggctgagaac cacgacccagacatcaaggagcacgtgaactccctgggggaaaagctgaagactctgcgg ctgaggctgcgccgctgtcatcgatttctgccctgcgagaacaagagcaaggcagtggag caggtgaagagcgcctttagtaagctccaagagagaggtgtctacaaagccatgagtgag tttgacatcttcatcaactacatagaaacctacatgacaatgaggatgaaaatctga

DBGET integrated database retrieval system