KEGG   Ailuropoda melanoleuca (giant panda): 100481788
Entry
100481788         CDS       T01329                                 

Gene name
SHH
Definition
(RefSeq) LOW QUALITY PROTEIN: sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04340  Hedgehog signaling pathway
aml04360  Axon guidance
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05217  Basal cell carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100481788 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100481788 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100481788 (SHH)
   05205 Proteoglycans in cancer
    100481788 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    100481788 (SHH)
   05217 Basal cell carcinoma
    100481788 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100481788 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100481788 (SHH)
Peptidases and inhibitors [BR:aml01002]
 Cysteine peptidases
  Family C46: hedgehog family
   100481788 (SHH)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Morphogens
   100481788 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 100481788
NCBI-ProteinID: XP_034505932
Ensembl: ENSAMEG00000001204
LinkDB
Position
1
AA seq 372 aa
MLQLARCLVLLLVSALLMCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLA
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAAAEREAPSGAGPPPGGAPG
RRVVAAPSHFSPPARFHGCSPFPTFTVDGVKSLCKVSVQXLLPASLVTKCVSTPVKSCIT
MYLKLFSLCSIV
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgctgcagctggcgagatgtctggtgctgcttctcgtctccgcactgctgatgtgcccg
gggctggcgtgcggacccggcaggggatttgggaagaggcggcaccccaaaaagctgacc
cctttagcctacaagcagtttatccccaacgtggctgagaagaccctaggggccagtgga
agatatgaagggaagatctcgagaaactccgagcgatttaaggaactcacccccaattac
aaccccgacatcatatttaaggatgaagaaaacacgggagcagaccggctgatgactcag
aggtgtaaggacaagctgaacgccttggccatctcggtgatgaaccagtggcccggcgtg
aagctgcgggtgaccgagggctgggacgaagacggccaccactcagaggagtcgctgcac
tacgagggccgtgcagtggacatcaccacgtcagaccgcgaccgaagcaagtacggcatg
ctggcgcgcctggccgtggaggctggcttcgactgggtgtactacgagtccaaagcgcac
atccactgctccgtgaaagcagagaattcggtggcggccaaatccggcggctgcttcccg
ggctcggccacggtgcacctggagcagggcggcaccaagctggtgaaagacctgcgcccc
ggggaccgcgtgctggcggccgatgaccagggccgactgctctacagcgacttcctcgcc
ttcctggaccgcgacgatggtgccaagaaggtcttctacgtgatcgagacgcgggagccg
cgcgaacgcttgctgctcaccgccgcgcacctgctcttcgtcgcgccgcacaacgactcg
gcggccgcggagcgggaggcgccgtcgggcgcggggccgccgccggggggcgcgccgggg
cgccgcgtggtggcagcaccctcccacttctccccgcctgcccggttccacggctgcagc
ccctttcccacctttacggtggacggtgtgaagagcttgtgcaaagtgtccgtgcagntg
ttgctgccagcctccctcgtgactaaatgcgtatctactcctgtcaaaagctgtatcaca
atgtacttgaaactgttctctttgtgctctattgtttga

DBGET integrated database retrieval system