KEGG   Ailuropoda melanoleuca (giant panda): 100481921
Entry
100481921         CDS       T01329                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04151  PI3K-Akt signaling pathway
aml04217  Necroptosis
aml04380  Osteoclast differentiation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04650  Natural killer cell mediated cytotoxicity
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100481921 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    100481921 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100481921 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100481921 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100481921 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    100481921 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    100481921 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100481921 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100481921 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100481921 (IFNAR1)
   05160 Hepatitis C
    100481921 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    100481921 (IFNAR1)
   05164 Influenza A
    100481921 (IFNAR1)
   05162 Measles
    100481921 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    100481921 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100481921 (IFNAR1)
   05169 Epstein-Barr virus infection
    100481921 (IFNAR1)
   05165 Human papillomavirus infection
    100481921 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:aml04050]
    100481921 (IFNAR1)
Cytokine receptors [BR:aml04050]
 Interleukin receptor families
  IFN receptor family
   100481921 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 100481921
NCBI-ProteinID: XP_002919632
Ensembl: ENSAMEG00000014939
LinkDB
Position
1
AA seq 579 aa
MLVEVTEDVTSLASGGPQTMFALLGATTLVLVAGVPWMLPAAAGGTNLKSPQNVEVYIVD
DTFILRWDRSSPSVRNVTFSADYQTLENDTWLKLPGCQSIANTKCNFSSLELNIYEEIKL
RIRAEEGNNTSPWHYVDSFTLFGKAQIGPPKVHLEAEDKAIIINITPPGTKDHGMWSLDS
SSFTYSLEIWKNSSSGDRRTETVYPRDKIYKLSPETTYCLKVKARLLPRKIGVFSPVYCI
KTTVENKLPPPENIQLDAENRIHVLKWDYAHENVTFQAQWLHAYLKKIPGDNSDKWKQIP
NCENVRTTQCVFPKNTFRKGIYLIRVRASDGNTTSVWSKEEKFDTQFQITLLPPVIAVKS
TNDVSLRVYISATEESENRAMNHPYSLTYEIVFWENTSNAERKIVDKRTDFTFPKLKPLT
AYCVKARALIQDEKWNKSSVFSDTVCEKTKPGNTSKTWLIAGVCAALLSIPVVVYVMKLL
FRCIGYVFFPSSKPPSAIDEYFSEQPLRNLLLFTSEEQTERCFIIENTNTIIAIEETHQT
DGEHKKYNSQTSQDSGNYSNEDESSESKLSEEFVHQETE
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgctggtcgaggtgaccgaggatgtgacttcgttggccagcggtggcccgcagacgatg
ttcgccctcctgggcgcgacgaccctggtgctggtcgctggggtgccgtggatgttgccc
gcagccgcaggaggaacaaatctaaagtctcctcaaaatgtagaggtctacatcgttgat
gatacctttatcctgagatgggacaggagcagtccatctgtcaggaatgtgactttttca
gcagattatcaaacacttgaaaatgatacttggttaaaattgcctggctgtcagtctatt
gccaataccaaatgcaacttttcttcactcgagctcaatatttatgaagaaattaaattg
cgaataagagcagaggagggaaacaacacttctccatggcattatgttgactcattcacc
ctatttggaaaagctcaaattggtcccccaaaagtacatttagaagccgaagataaggca
ataataataaacatcaccccacctggaacaaaagatcatggcatgtggtctctggatagc
tcaagctttacctacagcttagagatctggaaaaactcttcaagtggagacagaaggact
gaaactgtttaccccagagataaaatttataaactctcaccagagaccacttactgttta
aaagttaaagcaagacttttgccgagaaaaattggtgtctttagtcctgtgtattgtata
aagaccacagttgaaaataaactgcctccaccagaaaatattcaacttgatgctgaaaat
cgcatccatgttcttaaatgggattacgcacatgaaaatgtgacctttcaagctcagtgg
ctccatgcctatttaaaaaagattcctggggacaattcagataaatggaaacaaatacca
aactgtgaaaatgtccgaactacgcagtgtgtctttcccaaaaatactttccgaaaagga
atttaccttattcgtgttcgagcatctgatggaaataccacatctgtttggtctaaggaa
gaaaaatttgatactcaattccaaattaccctgcttcctccagtcattgccgtgaaatcc
actaacgatgtttccctgcgggtctatatcagcgccacagaagagtctgaaaacagggct
atgaaccatccttactcactaacttatgaaattgtattttgggaaaacacttcaaatgct
gagagaaaaattgtagataaaagaactgattttacttttccaaaattgaaaccactaact
gcatattgtgtcaaagccagagcactcattcaggatgaaaagtggaataaaagcagtgtt
ttcagtgatactgtgtgcgagaaaacaaaaccaggaaatacttccaaaacctggctcata
gctggagtgtgcgctgcattactttccatcccggttgtcgtctatgtcatgaaacttctc
tttagatgtatcggttatgtgttcttcccatcaagtaaacctccttctgctatagatgag
tatttctctgagcaaccactccggaatctcctccttttcacgtccgaggaacaaacggaa
aggtgttttatcattgaaaatacaaatactatcattgcaatagaagaaactcaccagact
gatggagagcacaaaaaatacaattcccaaaccagtcaagattcgggaaactattctaat
gaagatgaaagcagtgaaagcaaattgagtgaagaattcgtgcaccaggaaaccgagtga

DBGET integrated database retrieval system