KEGG   Ailuropoda melanoleuca (giant panda): 100482473
Entry
100482473         CDS       T01329                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04151  PI3K-Akt signaling pathway
aml04630  JAK-STAT signaling pathway
aml04640  Hematopoietic cell lineage
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04672  Intestinal immune network for IgA production
aml05140  Leishmaniasis
aml05200  Pathways in cancer
aml05310  Asthma
aml05320  Autoimmune thyroid disease
aml05321  Inflammatory bowel disease
aml05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100482473 (IL4)
   04151 PI3K-Akt signaling pathway
    100482473 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100482473 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100482473 (IL4)
   04660 T cell receptor signaling pathway
    100482473 (IL4)
   04658 Th1 and Th2 cell differentiation
    100482473 (IL4)
   04659 Th17 cell differentiation
    100482473 (IL4)
   04657 IL-17 signaling pathway
    100482473 (IL4)
   04664 Fc epsilon RI signaling pathway
    100482473 (IL4)
   04672 Intestinal immune network for IgA production
    100482473 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482473 (IL4)
  09163 Immune disease
   05310 Asthma
    100482473 (IL4)
   05320 Autoimmune thyroid disease
    100482473 (IL4)
   05321 Inflammatory bowel disease
    100482473 (IL4)
   05330 Allograft rejection
    100482473 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100482473 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100482473 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100482473 (IL4)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Interleukins
   100482473 (IL4)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Haparin
  Cytokines
   100482473 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 100482473
NCBI-ProteinID: NP_001291840
UniProt: Q3S4V6
LinkDB
AA seq 132 aa
MCLTSQLIPTLVCLLALTSTFVHGHNFNITIKEIIKTLNILTARNDTCMELTVTNIFAAP
KNTTDTETFCRATTVLQQLSTHSCSNKLLGGLHRNLKTMANMTCSVNEVKKSTLRDFLER
LKAIVQRKYYRH
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtgtctcacctcccaactgattccaactctggtctgcttactagcactcaccagcacc
ttcgtccacggacataacttcaatattaccattaaagagatcatcaaaacgttgaacatc
ctcacagcgagaaacgacacgtgcatggagctgaccgtcaccaacatcttcgctgcccca
aagaacacaactgatacggaaaccttctgcagagccacaactgtgcttcagcagctctct
acacacagttgctccaacaaactcctcggagggcttcacaggaacctcaagacaatggca
aacatgacctgttcagtgaatgaagtcaagaagagtacgctgagagacttcttggaaagg
ctaaaagcgatcgtgcaaaggaaatactacaggcactga

DBGET integrated database retrieval system