KEGG   Ailuropoda melanoleuca (giant panda): 100482510
Entry
100482510         CDS       T01329                                 

Gene name
ZBTB17
Definition
(RefSeq) zinc finger and BTB domain-containing protein 17
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100482510 (ZBTB17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482510 (ZBTB17)
   05202 Transcriptional misregulation in cancer
    100482510 (ZBTB17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100482510 (ZBTB17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100482510 (ZBTB17)
   04121 Ubiquitin system [BR:aml04121]
    100482510 (ZBTB17)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    100482510 (ZBTB17)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100482510 (ZBTB17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2HC_2 zf-C2H2_6 Zn-ribbon_8 zf-C2H2_11 zf-Di19 zinc_ribbon_15 zf_UBZ Packaging_FI
Other DBs
NCBI-GeneID: 100482510
NCBI-ProteinID: XP_034527967
Ensembl: ENSAMEG00000011788
LinkDB
Position
11
AA seq 588 aa
MAAMDFPQHSRHVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAACSEYFKMLFVDQK
DVVHLDISNAAGLGQVLEFMYTAKLSLSSENVDDVLAVASFLQMQDIITACHALKSLAEP
TTSPGENTVASAAEGGDKRAKEEKAAAPTLSEPDPAGSGPPTGPGREPKEERGGQAESTA
SGAEQTEKADAPREPPRVEPKPDPTSSMAAAEAEAALSESSEQEMEVEPARKGEEREEEG
AAAAEVKEEGPPLEKGEAPEESEESASTDSGQELGAEARGLRSGTYGDRTESKAYGSGRW
CRPLPCPLSAGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLAN
HIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKT
VHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVL
KAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQ
QYGPGSAWPAGQVLQAGELVFRPRDGADGQPALAEMPPTAPECPPPAE
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggcagccatggatttcccacagcacagccggcatgtcctggagcagctgaaccagcag
cggcagctgggactgttgtgtgactgcactttcgtggtggacggtgtcgacttcaaagcc
cataaggcggttctggcggcctgcagcgagtacttcaagatgctctttgtggaccagaag
gacgtggtgcacttggacatcagtaacgcggcaggcctggggcaggtgctggagttcatg
tacacggccaagctgagcctgagctctgagaatgtggacgacgtgttggccgtggccagc
ttcctgcagatgcaggacatcatcacggcctgccatgccctcaagtcactggctgagccg
accaccagccccggggagaatacggtggcctcggccgcggaaggaggagacaagagagcc
aaagaggagaaggcggctgcccccacactgagtgagccggaccccgccggcagtggtccg
cccacaggcccgggcagggagcccaaagaggagcggggcggccaggccgagagcacggcc
agcggtgccgagcagacggagaaggcggacgccccccgggagcccccgcgcgtggagccc
aagcccgaccccacgagcagcatggcagcggctgaggccgaggccgccttgtcggagagc
tcggagcaagagatggaggtggagccggccaggaaaggagaagagcgggaggaggagggc
gcagcggccgccgaggtcaaggaagaggggccccccctagagaagggggaggccccggag
gagagcgaggagtcggccagcaccgactcgggccaagagctgggcgccgaggcccggggc
ctgcgctcgggcacctacggcgaccgcacggagtccaaggcctacggctcggggcgctgg
tgccgacccttgccctgccccctgtccgcaggcgagaagccgtgccagtgcgtgatgtgc
ggcaaggccttcacgcaggccagctccctcatcgcccacgtgcgccagcacaccggggag
aagccctacgtctgcgagcgctgcggcaagaggttcgtccagtccagccaattggccaat
cacattcgccaccacgacaacattcgccctcacaagtgcagtgtgtgtagcaaggccttc
gtgaacgtgggggacctgtccaagcacatcatcatccacaccggagagaaaccttacctg
tgtgacaagtgcggacgtggtttcaaccgggtggacaacctacgttcccacgtgaagacc
gtgcaccagggcaaggcgggcatcaaaatcctggagccagaggaggggggtgaggtcagc
gtggtcaccgtggatgacatggtcacactggccactgaggcgctggcggcaacggctgtc
actcagctcacagtggtaccagtgggggccgcggtgaccgctgacgagacggaagtactt
aaggccgagatcagcaaagctgtgaagcaagtacaggaggaagaccccaacacccacatc
ctctatgcctgtgactcctgtggggacaagttcctggatgcgaacagccttgcccagcac
gtgcggatccacacggcccaggcactggtcatgttccagacggacgcggacttctaccag
cagtacgggccaggcagcgcgtggccggccgggcaggtgctgcaggctggggagctggtc
ttccgccctcgggacggggccgatggccagcccgctctggcagagatgccccccacagcc
cctgaatgtccaccgcctgctgagtga

DBGET integrated database retrieval system