KEGG   Ailuropoda melanoleuca (giant panda): 100482603
Entry
100482603         CDS       T01329                                 

Gene name
VAC14
Definition
(RefSeq) protein VAC14 homolog isoform X2
  KO
K15305  vacuole morphology and inheritance protein 14
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100482603 (VAC14)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100482603 (VAC14)
SSDB
Motif
Pfam: Vac14_Fig4_bd Vac14_Fab1_bd HEAT HEAT_EZ TAF6_C
Other DBs
NCBI-GeneID: 100482603
NCBI-ProteinID: XP_002920990
Ensembl: ENSAMEG00000002267
UniProt: D2HFV6
LinkDB
Position
12
AA seq 783 aa
MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQIKHVIQTLSQEF
ALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPVLTCFNDADSRLRYYACEALYNI
VKVARGAVLPHFNVLFDGLSKLAADPDPNVKSGSELLDRLLKDIVTESNKFDLVGFIPLL
RERIYSNNQYARQFIISWILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVL
GEFLKEIKKNPSSVKFAEMANILVIHCQTTDDLIQLTAMCWMREFIQLAGRVMLPYSSGI
LTAVLPCLAYDDRKKSIKEVANVCNQSLMKLVTPEDDEPDEPKPVAQRQVESNPDDSLAK
QEGTASGGPDGSCDASFSSSSSVFVPACTERAPVTLHLDGIVQVLNCHLSDMAIGMMTRI
AVLKWLYHLYIKTPRKMFRHTDSLFPILLQTLSDESDEVILKDLEVLAEIASSPAGQTDD
PGPLDGPDLRVSHSELQVPTPGRANLLNTPGTKGLECSPSTPTMNSYFYKFMINLLKRFS
SERKLLEARGAFIIRQLCLLLNAENIFHSMADILLREEDLKFASTMVHTLNTILLTSTEL
FQLRNQLKDLKTLESQNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDLIQKFGDLEVTV
DFLTEVDKLVQLIECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQC
VPNPELLQTEDSPQAAPKSQKADSPSINYTELLQHFEKVQKKHLEVRHQRSGRGDHLDRR
VVL
NT seq 2352 nt   +upstreamnt  +downstreamnt
atgaaccccgagaaagacttcgcgccgctcacgcccaacatcgtgcgcgccctcaatgac
aagctctacgaaaagcggaaggtggcagcgctggagatcgagaagctggtccgggagttc
gtagcccagaacaacaccgtgcaaatcaagcatgtaatccagaccctgtctcaggagttt
gccctgtctcagcacccgcacagccggaaggggggcctcatcggcctggccgcctgctcc
atcgcactgggcaaggactcggggctgtacctgaaggagctcatcgagccggtgctgacc
tgcttcaatgacgcggacagccggctgcggtactacgcgtgcgaggcgctgtacaacatc
gtcaaggtggcccgcggcgccgtgctgccccacttcaatgtgctctttgacgggctcagc
aagttggctgcagacccagaccccaatgtgaaaagtggatctgagctcctagaccgcctt
ttaaaggacatcgtgacggagagcaacaagtttgacctggtgggcttcatccctttgttg
cgggagaggatttactccaacaaccagtatgcccggcagttcatcatctcctggattctg
gttctggagtccgtgccagacatcaacctgctggattatttgccggagatcctagatggg
ctcttccagatcctgggcgacaacggcaaagagattcggaaaatgtgtgaggtggtcctt
ggagagttcttgaaagaaattaagaagaacccctccagtgtgaagtttgcggagatggcc
aacatcctggtgatccactgccagaccacagacgacctgatccagctgacggccatgtgc
tggatgcgggagttcatccagctggctggtcgggtgatgctgccctactcttctggaatc
ctgaccgctgtcttgccctgcctggcctacgatgaccgcaagaaaagcatcaaggaagtg
gccaacgtgtgtaaccaaagcctgatgaagctggtcacccctgaggatgacgagcctgac
gagccgaagcccgtggcgcagaggcaggtagagtccaaccccgatgactccctggccaag
caggaagggacagccagtggaggccccgatggttcttgtgacgccagcttcagtagcagc
agcagtgtcttcgtgccagcctgcaccgaaagggccccagtcaccctccaccttgatggg
attgtgcaggtcctgaactgccacctcagtgacatggccatcggcatgatgaccaggatc
gccgtcctgaagtggctctaccacctctatatcaagactccccggaagatgttccggcac
actgacagcctcttccccatcctgctgcagacgctatcggatgaatccgacgaggttatc
ctgaaggatctagaggtgttggcagaaattgcttcctctcctgcaggccagacagatgat
ccaggcccccttgatggccctgacctccgggtcagccactcagaacttcaggtgcccacc
cctggcagagccaacctgctgaacacccctggtaccaaaggcttagaatgttccccttcc
acccccaccatgaactcctacttttataagttcatgatcaaccttctcaagaggttcagc
agtgaacgcaagctcctggaggccagaggcgctttcatcatcaggcagctctgcctcctg
ctgaacgcagagaacatctttcactcgatggcagacatcctgctccgagaggaggacctc
aagttcgcctcaaccatggtccacaccctcaacaccatcctgctcacctccacagagctc
ttccagctgaggaaccagctcaaggacctgaagactctggagagccagaacctcttctgc
tgcctgtaccgctcctggtgccacaacccggtcacgacggtctccctgtgcttcctcacc
cagaactaccggcacgcctatgacctcatccagaagttcggcgacctggaggtcacggtg
gatttcctcacggaggtagacaagctggtgcagctgattgagtgccccatcttcacatat
ctgcgcctgcagctcctggacgtgaagaacaacccctacctgatcaaggccctctacggc
ctgctcatgctgctgccccagagcagtgccttccagctcctgtcgcaccggctgcagtgt
gtgcccaaccccgagctgctccagaccgaagacagcccacaggcagcccccaagtcgcag
aaagcagattccccgagcatcaactacacagaactgctgcagcactttgagaaggtccag
aagaagcacctggaagtgaggcaccagcggagcgggcgcggggaccacctggaccggagg
gttgtcctctga

DBGET integrated database retrieval system