KEGG   Ailuropoda melanoleuca (giant panda): 100482626Help
Entry
100482626         CDS       T01329                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100482626 (GPD2)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     100482626 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 FAD_oxidored EF-hand_8 GIDA Pyr_redox_2 EF-hand_5 EF-hand_9 NAD_binding_8 HI0933_like Thi4 Pyr_redox Pyr_redox_3 FAD_binding_3 RNA_pol_Rpb4
Motif
Other DBs
NCBI-GeneID: 100482626
NCBI-ProteinID: XP_002926311
Ensembl: ENSAMEG00000009827
UniProt: D2HUI8
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MAFQKAVKGTILVGGGALASILGLSQFAHYRRKQVNLAYVEAAECVSEPVNREPPSREAQ
LLTLQNMSEFDILVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPDTGKERVSGARCKDVLTGQEFDVRAKCVINATGPFTDTVRKM
DDKNATAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISDSGLITIAGGKWTTYRSMAEDTINAAIKAHSLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDYKKEEELETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESIGVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcaaaaggcagtgaaagggactattcttgttggaggcggtgctcttgcaagt
attctaggcctctctcaatttgctcattacagaaggaagcaagtgaacctggcctatgtg
gaagccgcggagtgcgtttccgaacctgtgaacagggagcctccctccagagaagcgcag
ctactgactttgcaaaacatgtctgaattcgatatcctcgtcattggaggaggagcgaca
gggtgtggctgtgcgctggatgccgtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccacggtggtgtgcga
tatcttcagaaggctatcatgaagttggatattgagcagtataggatggtaaaagaagcc
cttcacgagcgtgccaacctactagaaattgctccccatttatcagctccgttgcctata
atgcttccaatttacaagtggtggcagctaccttactactgggtaggaatcaagctatat
gatctggttgcaggaagtaattgcctgaaaagcagttatgtcctcagcaaatcaagagcc
cttgaacacttcccaatgctccagaaggacaaactggtaggagcaattgtctactatgac
ggacaacacaacgacgcacggatgaaccttgccattgccctcactgctgccaggtatggg
gctgccacagccaattacatggaggtagtgagcttgctcaagaagacagaccccgacacg
gggaaagagcgagtgagcggcgcgcggtgtaaggacgtgctcacagggcaggaatttgat
gtgagagccaaatgtgttatcaatgctacgggacctttcacagacaccgtgcgcaaaatg
gatgataagaacgccacggctatctgccagcccagcgccggggtccacatcgtgatgcct
ggttattacagccccgagagcatgggacttcttgacccagcaaccagtgatgggcgagtt
atcttcttcttaccctggcaaaagatgactatagctggcactactgacactccaactgat
gtcacacaccatcccattccttcggaagaagatatcaatttcattttgaatgaagtgcgt
aactacctgagttgtgatgttgaagtgagaagaggggatgtcctggcagcatggagtggt
atccgcccccttgtcacagatcccaagtctgcagatactcagtccatctcccgaaatcac
gtcgtggatatcagtgacagtggcctcatcactatagcaggtggcaagtggacaacgtat
cgctctatggcagaagataccataaacgctgctatcaaggctcacagtttgaaagcggga
ccaagcagaacagttgggcttttccttcaagggggcaaagattggagccccaccctctac
attaggcttgtccaggattacgggcttgaaagtgaggtggcacagcatcttgccgccact
tatggtgacaaggcttttgaggtggccaaaatggcaagcgtaactggaaaaaggtggccc
atcgtgggagtgcgtcttgtgtcagaatttccatacattgaagcagaggtgaaatatggg
attaaagaatatgcctgcacggcagtggacatgatttcacggaggactcgcctggccttc
ctaaatgtccaggcagcagaggaagccctacccaggattgttgaactgatgggcagagaa
ctgaattgggatgattataaaaaagaggaggaacttgaaacagccaggaaatttctgtat
tatgaaatgggctataaatctcgatcagaacagttaacagatcgctctgaaattagcctc
ctgccttctgacatcgacaggtacaagaagagatttcataagtttgatgcagaccaaaag
ggctttattaccattgttgatgttcagcgtgtattagagagtatcggcgtccaaatggat
gagaatacactacatgaaattctgaatgaagtagatttgaacaaaaatggacaggttgaa
ctcaatgagtttttgcagctgatgagtgctattcagaaaggaagggtgtccggaagccgg
ctcgcaatactaatgaaaactgcagaagagaacctcgacagacgagtccccattccagtg
gaccgaagttgtggaggactgtga

DBGET integrated database retrieval system