KEGG   Ailuropoda melanoleuca (giant panda): 100482674
Entry
100482674         CDS       T01329                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral-signaling protein isoform X1
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05164  Influenza A
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100482674 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    100482674 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    100482674 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100482674 (MAVS)
   05160 Hepatitis C
    100482674 (MAVS)
   05171 Coronavirus disease - COVID-19
    100482674 (MAVS)
   05164 Influenza A
    100482674 (MAVS)
   05162 Measles
    100482674 (MAVS)
   05168 Herpes simplex virus 1 infection
    100482674 (MAVS)
   05169 Epstein-Barr virus infection
    100482674 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 100482674
NCBI-ProteinID: XP_002918808
Ensembl: ENSAMEG00000010704
UniProt: G1LW07
LinkDB
Position
13
AA seq 525 aa
MKLAEDKTYEYIRHHFSNFVDRVHVPEILPYLSCLTTSDQDRLRASFQLSGNHGTLWDLF
NSLRRRIGWVESLIKALRACELVDLADEVARVYQSNLPRVQNRPPAPVEPQVVPAEVPRP
SRPDVAPSARHNGYREEEPSFPMPVQDTQPPESLEESSRRVPQLPQSGAVLRRPTSPVEP
SSDMAAFSPLTSSGHQEHDTELGSARTAGVASSLTSPRGPVSPTVSFQPLTRSIPRASRL
PAPSVSAVSPGTSSSSPGSACAGAAGDHGEASVCPGGAGVSSSSLPISTAPSRVPANAAF
DRTVPSKLPVTSKPSGAVATHVLTSLPPSKLPINSVRAGAAPPRVPAGLGPEHRMSVSTV
TSKLPASTVPATGSNIPSGEISAAPVPTSVSTRDSLPGLDPSSAGWSSELELSKPGRLAS
RVDSEPFSGCSADLALSYSNSVDAGPDNAPEENEYQSVDSIMIHVTQDPSVDLLEGNPGP
HTALQPLVEEESIQASLWAPWLRAAAAGALLAVLLTVLYRRRLLQ
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaagcttgccgaagataaaacttacgagtatatccgccaccatttcagcaattttgtt
gaccgcgttcatgttccggagatcctgccttacctgtcctgccttacgacaagtgaccag
gaccgactgcgggcctctttccagctctctgggaaccacggcaccctctgggacctcttc
aacagccttcggcggcggatcggctgggtggaatccctcatcaaagcgctgagggcctgt
gagctggtggatctcgctgatgaagtggcccgggtctaccagagcaacctgccccgtgtc
cagaaccggcctccagccccagtggagccacaggtagttcctgctgaggttccacggccc
tccagacctgatgtggcccccagtgcccgccacaacggctatagagaggaggagccaagt
ttccccatgcctgtccaggacacccaaccaccagagtccctggaagagagttcaaggaga
gtcccacagctgccccagtctggggctgtcctgaggaggccaaccagcccggtggagccc
tcctctgacatggcggcctttagccctctgacctccagtggacatcaagagcacgacaca
gaactgggcagtgcccgcacagcaggcgtggcctccagcctcacctccccccgtgggcct
gtgtctccaactgtctccttccagcccctgacccgctccatccccagggcaagccgtttg
cctgcaccctccgtgtcagctgtgtctcctggcacctcctcctcctcgcctggctcggcc
tgtgcaggggctgctggcgaccacggcgaggctagcgtctgccccggtggggcaggggtg
tccagcagctcattgcccatcagcacagccccctccagggtgcctgccaacgcagcattt
gacagaacagtgccttccaagttgcctgtcacctcgaaaccctccggtgctgtggccacc
cacgtgctcacgagtctgccaccgtccaaactgcccatcaactcagtacgtgcgggcgca
gcgccacccagagtgcctgctggcttggggccagagcacaggatgtctgtgagcacggtg
accagcaagctgcccgccagcacagtgcctgctaccgggagcaacataccctcgggggag
atttcagcggctccagtgcccaccagcgtctccaccagagacagcttgcctgggctagac
cccagctctgctggctggagctctgagttggagctgagcaagccaggcaggctggcctcc
cgggtggacagtgagccattctcgggctgctctgcggacctggcccttagctacagcaat
tccgtggacgcagggcctgacaatgccccagaggagaacgagtaccagtcggtggattcc
attatgatccacgtgacccaggatcccagcgtcgacctgctggagggtaatcctgggccg
cataccgccctgcagcccctggtggaggaggagtccatccaggccagcctctgggctccg
tggctcagggcagctgccgctggggcgctcctggccgtgctcctgaccgtgctatacagg
cggcgcctgctccagtga

DBGET integrated database retrieval system