KEGG   Ailuropoda melanoleuca (giant panda): 100482707
Entry
100482707         CDS       T01329                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04152  AMPK signaling pathway
aml04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100482707 (EEF2K)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100482707 (EEF2K)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     100482707 (EEF2K)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   100482707 (EEF2K)
SSDB
Motif
Pfam: Alpha_kinase Sel1 DUF1771
Other DBs
NCBI-GeneID: 100482707
NCBI-ProteinID: XP_002926096
Ensembl: ENSAMEG00000003619
UniProt: D2HU00
LinkDB
Position
10
AA seq 725 aa
MADEDLIFRLEGVDGGQTPRAGHNGESEADSDDEEGYFICPITDDPRSHQNVNSKVNNYY
SNLTKSEQYGSSGSPASSFHFKEAWKHAIKKAKHMPDPWAEFHLEDIATECATRHRYNAV
TGEWLEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQQWKGASNYVAKRYIESVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCVVELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNMRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTEKGTDFGDGNL
GVRGMALFFYSHACNRICKSMGLAPFDLSPRERDAVNQNTKLLQSSKTILRGTEEKCGSP
RVRTLSGSRPPLLLRLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLGN
MAPRDHDHLDNHRDSENSGDSGYPSEKRGELDDPEPREHGHSNGNRRYESDEDSLGSSGR
VCVEKWNLLNPSRLHLPRPSAVALEVQRLNALDLDKKIGKSILGKVHLAMVRYHEGGRFC
EKDEEWDRESAVFHLEHAADLGELEAIVGLGLMCSQLPHHILADVSLKDSEENKTKGFEY
LLKAAEAGDRQSMILVARAFDTGQNLSPDRSQDWPEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYTLLAREAEMLFTGGCGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYEKAEEAW
AQMEE
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggcagacgaagacctcattttccgcctggaaggtgttgatggcggccagaccccccgg
gctggtcacaatggtgagtccgaggccgacagcgacgatgaggaaggttacttcatctgc
cccatcaccgatgaccccaggtcacaccagaatgtcaattccaaggttaataactactac
agcaacctaacgaagagtgagcagtatgggtccagcgggtcccccgcaagctccttccat
tttaaggaagcttggaagcatgcgatcaagaaggccaaacacatgcctgacccctgggct
gagttccacctggaggatattgccacggaatgtgccacacgtcacaggtacaatgctgtc
accggggagtggctggaagatgaagttctcatcaagatggcgtctcagcccttcggccgt
ggagcaatgagggagtgcttcaggacgaagaagctttccaacttcctgcacactcagcag
tggaagggggcctccaactacgtggcaaagcgctacattgagtccgtggacagggacgtg
tactttgaggatgtgcgtctacagatggaggccaagctctggggagaggagtataatcgg
cacaaaccccccaagcaggtggacatcatgcagatgtgcgtggtggagctgaaggacaga
ccgggcaagcctctcttccacctggagcactatattgagggcaagtacatcaagtacaac
tccaactcgggctttgttcgcgatgacaacatgcgtctgacaccacaggccttcagccac
ttcacatttgagcgttccggacatcagctgattgtggtagacatccagggtgtgggcgac
ctctacactgacccgcagatccacaccgagaagggcactgactttggagatggcaatcta
ggtgttcggggaatggcgctcttcttctactctcacgcctgcaaccggatttgcaagagc
atgggcctcgctccctttgacctctcgccaagagagagggacgccgtgaatcagaacacc
aagctgctgcaatcgtccaagaccatcctgagggggacagaggaaaagtgtgggagcccc
cgagtaaggaccctctctgggagtcgccccccactgcttcttcgcctttcagagaactct
ggagatgagaacatgagtgacgtgacctttgactctcttccttcctccccgtcttcggcc
acaccacacagccagaaactggaccacctccattggcctgtgttcagtgaccttggcaac
atggcaccccgagaccacgaccatctggacaaccaccgggactctgaaaacagtggagac
agtggataccccagtgagaagcggggtgagctcgatgacccagagccccgcgaacatggc
cattccaacggtaaccggaggtacgagtcagacgaagacagcctgggcagctctggacgg
gtctgcgtggagaagtggaatctcctcaacccgtcccgcctccacctgccgagaccttcc
gccgtggccctggaagtgcaaaggcttaatgctctggacctggacaagaaaatcgggaag
tccattctgggaaaggtgcatttggccatggtgcgctaccatgagggtgggcgcttctgc
gagaaggacgaggagtgggaccgcgagtcggctgtcttccacctggagcacgcagccgac
ctgggcgagctggaggccatcgtgggcctggggctcatgtgctcacagctgccccaccac
atcctggccgacgtctctctgaaggattcagaagagaataaaaccaaaggatttgaatac
ttactgaaggcagctgaagctggcgacagacagtccatgatcctggtggctcgggctttt
gacacgggccagaacctcagcccagacaggtcccaagactggccagaggctctgcactgg
tacaacactgccctggagatgacagactgtgacgagggtggtgagtatgacgggatgcag
gatgagcctcggtacacgctgctggccagggaggccgagatgctgttcaccggtggctgc
ggactggagaaggacccacagagatcaggcgatttgtacacacaggcagccgaggcagcg
atggaagccatgaagggccggctggccaaccagtactatgagaaggcggaggaggcctgg
gcgcagatggaggaatag

DBGET integrated database retrieval system