KEGG   Ailuropoda melanoleuca (giant panda): 100482983
Entry
100482983         CDS       T01329                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04066  HIF-1 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04370  VEGF signaling pathway
aml04510  Focal adhesion
aml04926  Relaxin signaling pathway
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05219  Bladder cancer
aml05323  Rheumatoid arthritis
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100482983 (VEGFA)
   04014 Ras signaling pathway
    100482983 (VEGFA)
   04015 Rap1 signaling pathway
    100482983 (VEGFA)
   04370 VEGF signaling pathway
    100482983 (VEGFA)
   04066 HIF-1 signaling pathway
    100482983 (VEGFA)
   04020 Calcium signaling pathway
    100482983 (VEGFA)
   04151 PI3K-Akt signaling pathway
    100482983 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100482983 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100482983 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482983 (VEGFA)
   05206 MicroRNAs in cancer
    100482983 (VEGFA)
   05205 Proteoglycans in cancer
    100482983 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100482983 (VEGFA)
   05211 Renal cell carcinoma
    100482983 (VEGFA)
   05219 Bladder cancer
    100482983 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100482983 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100482983 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100482983 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100482983 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100482983 (VEGFA)
   05165 Human papillomavirus infection
    100482983 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100482983 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100482983 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100482983 (VEGFA)
Cytokines and growth factors [BR:aml04052]
 Growth factors
  Growth factors (RTK binding)
   100482983 (VEGFA)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100482983 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 100482983
NCBI-ProteinID: XP_034503844
LinkDB
Position
19
AA seq 516 aa
YSFIQGLPSSFFSSAILKSTFFPVLIYFLLPVPRLNRADRLGRLLLYFPKSLRILETSRE
KKEVARAPERSRGRERETGSESARGRASNDRDRGKVSDLLLGVTARARREPSPSGSRSGP
AALTDRQTDTAPRPSAHLLPGRRPRVDAAASRGQEPEPAPAGGVEGVGARGVAVKLFVQL
LGCSRSGGAVVRAGAAEPSGTGRSASSGREEPQSEEGEEEEEKEEERGPRWRLGARKPGS
WTGEAAVCADSAPAARAPQALARASAPGGRGDSLGAEESGPPRSPSRRGSASRAGSGRAS
ETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGEHKPHEVVKFMDVYQRSYCRPIETLV
DILQEYPDEVEYIFKPSCVPLMRCAGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGE
MSFLQHSKCECRPKKDRARQEKKSIGGKGKGQKRKRKKSRYKPWSVPCGPCSERRKHLFV
QDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 1551 nt   +upstreamnt  +downstreamnt
tattcatttatccagggtttaccctcctcctttttttcttcagcaattttaaaatccaca
ttctttcccgttttaatttattttttgcttcccgttccccgcttaaatcgggccgaccgt
ttggggagattgctcctttacttccccaaatcacttcggattttggaaaccagcagagag
aagaaagaggtagcaagagctccagagagaagtcgaggaagagagagagagacggggtca
gagagcgcgcgcgggcgagcgagcaacgacagggacaggggcaaagtgagtgacctgctt
ttgggggtgaccgccagagcgcggcgtgagccctccccctcgggatcccgcagcggacca
gcagcgctgacggacagacagacagacaccgccccccgccccagtgcccacctcctcccc
ggccggcggccgagggtggacgcggcggcgagccgcgggcaagagccggagcccgcgcct
gcaggcggagtggagggggtcggggctcgcggcgttgcagtgaaacttttcgtccaactt
ctgggttgttcccgctccggaggagccgtggtccgcgccggggcagccgagccgagcgga
accgggagaagtgctagctcgggccgggaggagccgcagtcggaggagggggaggaggaa
gaagagaaggaagaggagagggggccgcggtggcgactcggcgctcggaagccgggctca
tggacgggtgaggcggctgtgtgcgcagacagtgctccagccgcgcgcgcgccccaggcc
ctggcccgggcctcggctccaggaggaagaggagacagcctaggcgccgaagagagcggg
ccgccccgcagtccgagccggagagggagcgcgagccgcgccggctccggccgggcctcc
gaaaccatgaactttctgctctcttgggtgcattggagccttgccttgctgctctacctc
caccatgccaagtggtcccaggctgcacccatggcagaaggagagcacaaaccccacgaa
gtggtgaagttcatggacgtctaccagcgcagctactgccgtcccatcgagaccctggtg
gacatcctccaggagtaccccgacgaggtcgagtacatcttcaagccgtcctgcgtgccc
ctgatgcggtgtgcgggctgttgtaatgacgagggcctggagtgcgtgcccaccgaggag
ttcaacatcaccatgcagattatgcggatcaaacctcatcaaggccagcacatcggggag
atgagcttcctacagcatagcaaatgtgaatgcagaccaaagaaagatagagcaaggcaa
gaaaaaaaatcaattggaggaaagggaaaggggcaaaaaagaaagcgcaagaaatcccgg
tataaaccctggagcgttccctgtgggccttgctcagagcggagaaagcatttgtttgta
caagatccgcagacctgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgagg
cagcttgagttaaacgaacgtacttgcagatgtgacaagcccaggcggtga

DBGET integrated database retrieval system