KEGG   Ailuropoda melanoleuca (giant panda): 100482997
Entry
100482997         CDS       T01329                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00310  Lysine degradation
aml01100  Metabolic pathways
aml04010  MAPK signaling pathway
aml05200  Pathways in cancer
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100482997 (MECOM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100482997 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482997 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100482997 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100482997 (MECOM)
   03036 Chromosome and associated proteins [BR:aml03036]
    100482997 (MECOM)
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     100482997 (MECOM)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    100482997 (MECOM)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100482997 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 100482997
NCBI-ProteinID: XP_011220924
Ensembl: ENSAMEG00000002052
LinkDB
Position
1
AA seq 1240 aa
MRSKGRARKLATSNECVYGSYSAIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDP
SYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLRDIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFAT
SSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSS
LNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGL
TFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQ
DILKALSKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGS
DLESDIESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVN
DSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLP
LKMEPQSPNEVKKLQKGSSESPFDLTTKRKDEKPLTPGPSKPPATPVTSQDQPLDLSMGS
RSRASGTKLTEPRKNHVFGEKKGSNIEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDP
LEALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSM
FNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFS
ISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELES
TGAILDDKEDAYFTEIRNFIGDSNHSSQSPRNTEERMNGSHFKDEKALVTGQTSDLLDDE
DVEDEVLLGEEEEDNDITGKMGKEPGTSNVHEENPEDDYEETSALEMSCKTSPVRYKEEE
YKTGLSALDHIRHFTDSLKMRKLEDNQYTEAELSSFSASHVPEELKQPLHRKSKSQAYAM
MLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3723 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgtatatggcagc
tactctgcaattcctttggaagaaatgccagatgcagatggagtagccagcactccctcc
ctcaatatccaagagccatgctctccagccacatccagcgaagctttcactccaaaggag
ggctctccatacaaagcccccatctacatccctgatgatatccccattcctgctgagttt
gaacttcgagagtcaaatatgcctggagcaggactaggaatatggaccaaaaggaagatt
gaagctggtgaaaagtttgggccttatgtgggagagcagaggtcaaacctgaaagacccc
agctatggatgggagatcttagatgagttttgcaatgtgaagttctgcatagatgctagt
caaccagatgtaggaagctggctcaagtacatcaggttcgctggctgttatgatcaacac
aacctcgttgcatgccagataaatgaccagatattttatagagtagtcgcagacattgcc
ccaggagaagagctcctgctgttcatgaagagtgaagactatccccatgaaactatggcg
ccggatatccacgaagaacggcagtatcgctgcgaggactgtgaccagctctttgagtcc
aaggctgaactagcagatcaccagaagttcccctgcagtacccctcactcagcattttca
atggtggaagaagacttccaacaaaaactcgaaagtgaaaacgatctccgagacatacat
gcaatccaggagtgtaaggaatgtgaccaagttttccccgatttgcaaagcctggagaaa
cacatgttgtcacatactgaagagagggaatacaagtgcgatcagtgtcccaaggcattt
aactggaagtccaatctaattcgccaccagatgtcacatgacagtggaaagcactatgaa
tgtgaaaactgtgccaagcaggttttcacggaccctagcaaccttcagcggcacatccgc
tctcagcatgttggtgcccgggcccacgcatgcccggagtgtggcaaaacgtttgccact
tcgtcgggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatctgtgag
gtctgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgct
gattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcc
ttaaataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggatttttt
ggccaaggcatttcacttcctggaacccccgctatggataaaacgtccatggttaatatg
agtcatgccaacccgggccttgctgactattttggtgccaataggcatcccgctggtctt
acctttccaacagctcctggattttcttttagcttccctggtctgtttccttccggcttg
taccacaggcctcctttgatacctgctagctctcctgttaaaggactatcaagtactgaa
cagacaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacag
gatattttgaaagcactatctaaacacccacctgtaggagacaataagccagtggagctc
cagcccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtcagagagt
agtgaccttgatgatgtcagtacgccaagtggcagtgacctggaaacaacctcgggctct
gatctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttc
aaagacaaagtaagccctcttcagaatctggcttcaatacataataagaaagaatacagc
aatcattccattttctcaccatctttagaggagcagactgcggtgtcaggagctgtgaat
gattctataaaggctattgcttctattgctgaaaaatactttggttcaacaggactggtg
gggctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccattt
tttccagcattctctcaatcaatgtacccatttcctgatagagacttgagatcgttacct
ttgaaaatggaaccccaatcaccaaatgaagtaaagaaactgcagaagggaagctctgag
tctccctttgatctcaccactaagcgaaaggacgagaagcccttgactccaggaccctcc
aagcctccagcaacacctgtcacaagccaagaccagcccctggatctaagtatgggcagt
aggagtagagccagtggaacaaagctgactgagccccgtaaaaaccacgtgtttggggaa
aagaaaggaagcaatattgaaccaagacccgcatcggacggttccttgcagcacgctaga
cccactcctttctttatggacccaatttacagagtagagaaaagaaaactaactgaccca
cttgaagctttaaaagagaaatacttgagaccttctccaggattcttatttcacccacaa
ttccaactgcctgatcagagaacttggatgtcagctattgaaaacatggcagagaagtta
gagagcttcagtgccctgaaaccggaggccagcgaacttctgcagtcagttccctccatg
ttcaacttcagggcacctcccaatgccctgccggagaacctcctgcggaaagggaaagaa
cgctacacctgcagatactgtggcaagatttttccaaggtctgcgaacttaacacggcac
ttgagaacccacacaggagagcaaccttacagatgcaaatactgtgacagatcctttagc
atctcttccaacttgcagaggcatgtccggaacatccacaataaggagaagccctttaag
tgtcacttatgtgataggtgttttggtcaacaaaccaacttagacagacacctaaagaaa
catgagaatgggaacatgtctggtacggcaacgtcgtcgcctcattccgaactggagagt
acaggcgcgattctcgatgacaaagaagatgcttacttcacagaaatccgcaatttcatt
ggggacagcaaccacagcagccaatctcccaggaacacagaggagagaatgaacggcagt
cattttaaggatgagaaagctttggtgaccggccaaacttcagatttactggatgatgaa
gacgtagaagatgaggtgttgttaggggaggaggaggaagacaacgatattactggaaaa
atgggaaaagaacccgggacaagcaatgtacatgaagaaaaccctgaggatgactatgaa
gaaaccagcgccctggagatgagttgcaaaacgtccccagtgaggtataaagaggaagaa
tataaaactggactttctgctctagatcatataaggcacttcacagatagcctcaaaatg
aggaaactggaagataatcaatatactgaagctgagctgtcttcttttagtgcttcccat
gtgccggaggaacttaaacagccgttacacagaaagtccaaatcacaggcatatgctatg
atgttgtcactgtccgacaaggagtccctccattctacatcccacagttcttccaacgtg
tggcacagtatggcaagggctgcggcggaatccagtgccatccagtccataagccacgta
tga

DBGET integrated database retrieval system