KEGG   Ailuropoda melanoleuca (giant panda): 100482997
Entry
100482997         CDS       T01329                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00310  Lysine degradation
aml01100  Metabolic pathways
aml04010  MAPK signaling pathway
aml05200  Pathways in cancer
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100482997 (MECOM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100482997 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482997 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100482997 (MECOM)
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     100482997 (MECOM)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    100482997 (MECOM)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100482997 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 100482997
NCBI-ProteinID: XP_011220924
Ensembl: ENSAMEG00000002052
LinkDB
Position
1
AA seq 1240 aa
MRSKGRARKLATSNECVYGSYSAIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDP
SYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLRDIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFAT
SSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSS
LNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGL
TFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQ
DILKALSKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGS
DLESDIESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVN
DSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLP
LKMEPQSPNEVKKLQKGSSESPFDLTTKRKDEKPLTPGPSKPPATPVTSQDQPLDLSMGS
RSRASGTKLTEPRKNHVFGEKKGSNIEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDP
LEALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSM
FNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFS
ISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELES
TGAILDDKEDAYFTEIRNFIGDSNHSSQSPRNTEERMNGSHFKDEKALVTGQTSDLLDDE
DVEDEVLLGEEEEDNDITGKMGKEPGTSNVHEENPEDDYEETSALEMSCKTSPVRYKEEE
YKTGLSALDHIRHFTDSLKMRKLEDNQYTEAELSSFSASHVPEELKQPLHRKSKSQAYAM
MLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3723 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgtatatggcagc
tactctgcaattcctttggaagaaatgccagatgcagatggagtagccagcactccctcc
ctcaatatccaagagccatgctctccagccacatccagcgaagctttcactccaaaggag
ggctctccatacaaagcccccatctacatccctgatgatatccccattcctgctgagttt
gaacttcgagagtcaaatatgcctggagcaggactaggaatatggaccaaaaggaagatt
gaagctggtgaaaagtttgggccttatgtgggagagcagaggtcaaacctgaaagacccc
agctatggatgggagatcttagatgagttttgcaatgtgaagttctgcatagatgctagt
caaccagatgtaggaagctggctcaagtacatcaggttcgctggctgttatgatcaacac
aacctcgttgcatgccagataaatgaccagatattttatagagtagtcgcagacattgcc
ccaggagaagagctcctgctgttcatgaagagtgaagactatccccatgaaactatggcg
ccggatatccacgaagaacggcagtatcgctgcgaggactgtgaccagctctttgagtcc
aaggctgaactagcagatcaccagaagttcccctgcagtacccctcactcagcattttca
atggtggaagaagacttccaacaaaaactcgaaagtgaaaacgatctccgagacatacat
gcaatccaggagtgtaaggaatgtgaccaagttttccccgatttgcaaagcctggagaaa
cacatgttgtcacatactgaagagagggaatacaagtgcgatcagtgtcccaaggcattt
aactggaagtccaatctaattcgccaccagatgtcacatgacagtggaaagcactatgaa
tgtgaaaactgtgccaagcaggttttcacggaccctagcaaccttcagcggcacatccgc
tctcagcatgttggtgcccgggcccacgcatgcccggagtgtggcaaaacgtttgccact
tcgtcgggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatctgtgag
gtctgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcatgct
gattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcc
ttaaataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggatttttt
ggccaaggcatttcacttcctggaacccccgctatggataaaacgtccatggttaatatg
agtcatgccaacccgggccttgctgactattttggtgccaataggcatcccgctggtctt
acctttccaacagctcctggattttcttttagcttccctggtctgtttccttccggcttg
taccacaggcctcctttgatacctgctagctctcctgttaaaggactatcaagtactgaa
cagacaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacag
gatattttgaaagcactatctaaacacccacctgtaggagacaataagccagtggagctc
cagcccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtcagagagt
agtgaccttgatgatgtcagtacgccaagtggcagtgacctggaaacaacctcgggctct
gatctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttc
aaagacaaagtaagccctcttcagaatctggcttcaatacataataagaaagaatacagc
aatcattccattttctcaccatctttagaggagcagactgcggtgtcaggagctgtgaat
gattctataaaggctattgcttctattgctgaaaaatactttggttcaacaggactggtg
gggctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccattt
tttccagcattctctcaatcaatgtacccatttcctgatagagacttgagatcgttacct
ttgaaaatggaaccccaatcaccaaatgaagtaaagaaactgcagaagggaagctctgag
tctccctttgatctcaccactaagcgaaaggacgagaagcccttgactccaggaccctcc
aagcctccagcaacacctgtcacaagccaagaccagcccctggatctaagtatgggcagt
aggagtagagccagtggaacaaagctgactgagccccgtaaaaaccacgtgtttggggaa
aagaaaggaagcaatattgaaccaagacccgcatcggacggttccttgcagcacgctaga
cccactcctttctttatggacccaatttacagagtagagaaaagaaaactaactgaccca
cttgaagctttaaaagagaaatacttgagaccttctccaggattcttatttcacccacaa
ttccaactgcctgatcagagaacttggatgtcagctattgaaaacatggcagagaagtta
gagagcttcagtgccctgaaaccggaggccagcgaacttctgcagtcagttccctccatg
ttcaacttcagggcacctcccaatgccctgccggagaacctcctgcggaaagggaaagaa
cgctacacctgcagatactgtggcaagatttttccaaggtctgcgaacttaacacggcac
ttgagaacccacacaggagagcaaccttacagatgcaaatactgtgacagatcctttagc
atctcttccaacttgcagaggcatgtccggaacatccacaataaggagaagccctttaag
tgtcacttatgtgataggtgttttggtcaacaaaccaacttagacagacacctaaagaaa
catgagaatgggaacatgtctggtacggcaacgtcgtcgcctcattccgaactggagagt
acaggcgcgattctcgatgacaaagaagatgcttacttcacagaaatccgcaatttcatt
ggggacagcaaccacagcagccaatctcccaggaacacagaggagagaatgaacggcagt
cattttaaggatgagaaagctttggtgaccggccaaacttcagatttactggatgatgaa
gacgtagaagatgaggtgttgttaggggaggaggaggaagacaacgatattactggaaaa
atgggaaaagaacccgggacaagcaatgtacatgaagaaaaccctgaggatgactatgaa
gaaaccagcgccctggagatgagttgcaaaacgtccccagtgaggtataaagaggaagaa
tataaaactggactttctgctctagatcatataaggcacttcacagatagcctcaaaatg
aggaaactggaagataatcaatatactgaagctgagctgtcttcttttagtgcttcccat
gtgccggaggaacttaaacagccgttacacagaaagtccaaatcacaggcatatgctatg
atgttgtcactgtccgacaaggagtccctccattctacatcccacagttcttccaacgtg
tggcacagtatggcaagggctgcggcggaatccagtgccatccagtccataagccacgta
tga

KEGG   Ailuropoda melanoleuca (giant panda): 100484679
Entry
100484679         CDS       T01329                                 

Gene name
RUNX1
Definition
(RefSeq) runt-related transcription factor 1 isoform X1
  KO
K08367  runt-related transcription factor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04530  Tight junction
aml04659  Th17 cell differentiation
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100484679 (RUNX1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100484679 (RUNX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100484679 (RUNX1)
   05202 Transcriptional misregulation in cancer
    100484679 (RUNX1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100484679 (RUNX1)
   05220 Chronic myeloid leukemia
    100484679 (RUNX1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    100484679 (RUNX1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 100484679
NCBI-ProteinID: XP_034511716
LinkDB
Position
1
AA seq 471 aa
MASDSIFESFPSYPQCFMRGGYFVAEYASHHRNLPRPSIEVKASYAQDATLPASSEAGVR
GSDKEQSRLPFDPSECVHGMNPSRDVHDASTSRRFTPPSTALSPGKMSEALPLGAPDAGA
ALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVP
DGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQ
VATYHRAIKITVDGPREPRNTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASG
MSTLSAELSSRLTTAPDLTAFGDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMS
AMSSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRIL
PPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggcttcagacagcatatttgagtcatttccttcgtacccacagtgcttcatgagaggt
ggttattttgttgctgaatatgcatcacatcacagaaatctgcctcgaccctccattgaa
gtcaaagccagttacgctcaggatgctaccctcccagcttcctcggaggccggagtgagg
gggtctgacaaagagcaaagccgcctcccttttgacccctcagaatgtgtacatggaatg
aatccatctagagatgttcacgatgccagcacgagccgccgcttcacgccgccttccacc
gcgctgagcccgggcaagatgagcgaggcgctgccgctgggcgccccggacgccggcgcc
gccctggccggcaagctgaggagcggcgaccgcagcatggtggaggtgctggccgaccac
cccggcgaactggtgcgcacagacagccccaacttcctctgctccgtgctgcccacgcac
tggcgctgcaacaagaccctgcccatcgctttcaaggtggtggctctgggagatgtccct
gatggcactctggtcactgtgatggcgggcaatgacgaaaactactcagctgaactgaga
aatgccaccgcagccatgaaaaaccaagttgcgagattcaatgacctcaggtttgtcggt
cggagtggaagagggaaaagcttcactctgaccatcaccgtctttacaaatccaccgcaa
gttgccacttaccacagagccatcaaaatcaccgtggatggaccccgagaacctcgaaac
acaaggcagatccagccatccccaccgtggtcctatgatcagtcctaccagtacctggga
tcgatagcctccccttccgtacacccggcaacacccatctcacctggacgggccagtggc
atgagcaccctctctgcagagctttccagtcgactcacaacggcccccgacctgacggcc
ttcggcgacccgcgccagttccccgcgctgccctccatctcagaccctcgcatgcactac
cccggcgccttcacctactccccgacgcccgtcacgtcgggcatcggcatcggcatgtcg
gccatgagctcggccacgcgctaccacacgtacctgccgccgccctaccccggctcgtcg
caggcacagggcggccccttccaggccagctcgccctcctaccacctgtactacggcgcc
tcggccggctcctaccagttctccatggtgggcggcgagcgatcgcctccgcgtatcctg
ccgccctgcaccaacgcctccacgggctcggcactgctcaaccccagcctcccgaaccag
agcgacgtggtggaggccgagggcagccacagcaactcgcccaccaacatggcgcccgcc
gcgcgcctcgaggaggccgtgtggcggccctactga

DBGET integrated database retrieval system