KEGG   Ailuropoda melanoleuca (giant panda): 100483034Help
Entry
100483034         CDS       T01329                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00020  Citrate cycle (TCA cycle)
aml00190  Oxidative phosphorylation
aml01100  Metabolic pathways
aml01200  Carbon metabolism
aml04714  Thermogenesis
aml04932  Non-alcoholic fatty liver disease (NAFLD)
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100483034 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100483034 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100483034 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100483034 (SDHA)
   05012 Parkinson disease
    100483034 (SDHA)
   05016 Huntington disease
    100483034 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100483034 (SDHA)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100483034 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100483034
NCBI-ProteinID: XP_002926686
Ensembl: ENSAMEG00000008480
LinkDB All DBs
Position
Un
AA seq 665 aa AA seqDB search
MSGVRAVSRLLGARRLALTRAQWPTTRQTGSRGFHFTVDGNKRSSAKVSDSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAIRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKI
SQLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKE
RIDEYDYSKPIQGQQKKLFEEHWRKHTLSYVDVQTGKVSLEYRPVIDKTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccgggcggtgtctcggctgttgggcgcccggcgcctggcactgaccagg
gcgcagtggccaacgacaaggcagacaggctcccgcggttttcacttcactgttgatggg
aataagaggtcttctgcgaaagtttccgattcaatttctacgcagtacccagtagtggac
catgagttcgatgcggtggtggtaggtgctggaggggcaggcctgcgagctgcgtttggc
ctttccgaggctgggtttaacacggcctgcgtcacaaagctctttcctaccagatcacac
accgttgcagcccagggaggaatcaatgctgctctggggaacatggaggaagacaactgg
aggtggcacttctacgacaccgtgaagggctccgactggctgggggaccaggacgccatc
cactacatgacagagcaggcacctgcttccgtggtagagctggagaattatggcatgcca
tttagcagaactgaagatgggaggatttaccagcgtgcttttggcggacagagcctcaag
tttgggaaaggcgggcaggcccaccggtgctgctgtgtggctgaccgcaccggccactca
ctgctgcacacgttgtatggaaggtctctgcgatatgataccagctattttgtagagtat
tttgctttggatctcctgatggaaaatggggagtgtcgtggtgttatcgcactgtgcata
gaggatgggtccatccatcgcataagagccaagaacactgttgtagctaccggaggctac
gggcgtacctacttcagctgcacctctgcccacaccagcaccggtgatggcaccgccatg
gtcaccagggcaggccttccctgccaggacttggagtttgttcagttccaccccacaggt
atatatggtgctggttgtctcattacggaagggtgccgtggagaaggaggcattctcatt
aacagccaaggtgaaaggttcatggagcgatatgccccagtcgcaaaggacctggcgtcc
agagacgttgtatctcggtccatgactctggaaatccgtgaaggaagaggctgtggccct
gagaaagatcacgtctacctgcagttgcaccacctaccccccgagcagctggccatacgc
ctgcctggcatttcagagacagccatgatcttcgcaggcgtggatgtcaccaaggagccg
atccctgtccttcccactgtgcattataacatgggtggtattcccaccaactacaagggc
caggttctgaggcatgtgaatggccaggatcagatcgtgcccggcctgtatgcctgtggg
gaggccgcctgtgcctcagtgcacggtgccaaccgtctcggggcaaactcgctcttggac
ctggtcgtcttcggccgggcgtgtgccctgagtattgcagagtcctgcagacccggagat
aaagttcccccaattaaaccaaatgctggggaagagtctgttatgaatcttgacaaattg
agatttgctgatggaagcataagaacatcagaactacgactcagcatgcagaagtcgatg
caaagtcatgccgcagtgtttcgtgtgggaagtgtgttacaggaaggatgtgagaaaatc
agccagctctatggagacctaaaacatctgaagacatttgaccgaggaatggtctggaac
accgacctggtggagaccctggaactgcagaacctgatgctctgtgcgcttcagaccatt
tacggagcagaggcccggaaggagtctcgtggtgctcatgccagggaagactacaaggag
cggattgacgagtatgattactccaagcccattcaggggcagcagaaaaagctgtttgag
gagcactggcggaagcacaccctttcctatgttgatgtccagactggaaaggtttcattg
gaatacagaccagtgatcgacaaaactttaaatgaggctgactgtgccacagtccctcca
gccattcgctcctactga

DBGET integrated database retrieval system