KEGG   Ailuropoda melanoleuca (giant panda): 100483216
Entry
100483216         CDS       T01329                                 

Gene name
TRAF6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04064  NF-kappa B signaling pathway
aml04120  Ubiquitin mediated proteolysis
aml04140  Autophagy - animal
aml04144  Endocytosis
aml04380  Osteoclast differentiation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04722  Neurotrophin signaling pathway
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05222  Small cell lung cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100483216 (TRAF6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100483216 (TRAF6)
   04064 NF-kappa B signaling pathway
    100483216 (TRAF6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100483216 (TRAF6)
   04140 Autophagy - animal
    100483216 (TRAF6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100483216 (TRAF6)
   04621 NOD-like receptor signaling pathway
    100483216 (TRAF6)
   04622 RIG-I-like receptor signaling pathway
    100483216 (TRAF6)
   04657 IL-17 signaling pathway
    100483216 (TRAF6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100483216 (TRAF6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100483216 (TRAF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100483216 (TRAF6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100483216 (TRAF6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100483216 (TRAF6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100483216 (TRAF6)
   05135 Yersinia infection
    100483216 (TRAF6)
   05133 Pertussis
    100483216 (TRAF6)
   05152 Tuberculosis
    100483216 (TRAF6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100483216 (TRAF6)
   05161 Hepatitis B
    100483216 (TRAF6)
   05160 Hepatitis C
    100483216 (TRAF6)
   05171 Coronavirus disease - COVID-19
    100483216 (TRAF6)
   05162 Measles
    100483216 (TRAF6)
   05168 Herpes simplex virus 1 infection
    100483216 (TRAF6)
   05169 Epstein-Barr virus infection
    100483216 (TRAF6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100483216 (TRAF6)
   05140 Leishmaniasis
    100483216 (TRAF6)
   05142 Chagas disease
    100483216 (TRAF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100483216 (TRAF6)
   04121 Ubiquitin system [BR:aml04121]
    100483216 (TRAF6)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100483216 (TRAF6)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100483216 (TRAF6)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100483216 (TRAF6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 zf-RING_5 Tropomyosin_1 SlyX Spc29 U-box DUF16 DUF4455 PspA_IM30 Med21 DUF3450 EzrA UPF0242 Laminin_II CENP-F_leu_zip DUF1664
Other DBs
NCBI-GeneID: 100483216
NCBI-ProteinID: XP_002926543
Ensembl: ENSAMEG00000013844
UniProt: G1M5H7
LinkDB
Position
16
AA seq 541 aa
MSLLNCENSCGSSQSESDCCAAMASSCSAAAKDDSVSGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMNCLQCQRPFQKCQLNIHIHK
ECPRRQVSCMNCAALMAFEDKEVHDQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAPI
PCTFSTFGCHVKMQRNHLARHLQENTQSHMRMLAQAVQSLSLALAPVPQRDMPPYDSSSV
SRVSTPCHPEVHNFQETIQQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKV
AEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQ
RCANYISLFVHTMQGEYDSHLPWPFQGTIRLAILDQSEAPVRQNHEEIMDAKPELLAFQR
PTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDSG
T
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgagtctgctaaactgtgaaaacagctgtggatccagccagtctgaaagtgactgctgt
gccgccatggccagctcctgtagcgctgcagctaaagatgacagtgtgagtggaaccgcc
agcacggggaacctctccagctcttttatggaagagatccaggggtatgatgtggagttt
gacccacctctagaaagcaagtatgaatgccccatctgcctgatggcattacgggaagca
gtacaaacaccatgtggccacaggttctgcaaagcttgcatcatcaaatcaataagggat
gctggtcacaaatgtccagttgacaatgaaatattgctggaaaatcaactatttcctgac
aattttgcaaaacgagagattctttctctgatggtgaagtgtccaaatgaaggttgtttg
cacaagatggaactgaggcatcttgaggatcaccaagcacattgtgaatttgctctcatg
aattgtctccagtgccaacgtcccttccaaaaatgccaacttaatattcacattcataag
gagtgcccgaggagacaagtttcttgcatgaactgtgctgcgttgatggcatttgaagat
aaagaggtgcatgaccagaactgtcctttggcaaatgtcatctgtgaatactgcaatacc
atgctcatcagagaacagatgcctaatcactatgatctagactgtccaacagccccaatt
ccatgcacattcagtactttcggctgccatgtaaagatgcagcggaatcacttggcacgc
cacctacaagagaatacgcagtcgcacatgagaatgttggctcaggctgttcagagttta
agtcttgctttagctcctgtacctcagcgtgatatgccgccgtatgattcttcctccgtg
tcccgggtctctactccgtgtcacccagaggtccataatttccaagaaaccattcagcag
ttagagggtcgcctcgtaagacaagaccatcaaatccgagagctcactgctaaaatggaa
actcagagcatgtacgtgagtgagctcaagcgaactatccgaacccttgaagacaaagtt
gctgaaatagaagcgcagcagtgcaacggcatctacatctggaagatcggcaactttggg
atgcatttgaaatctcaggaggaggagaaacctgttgtcattcacagccctggattctac
acaggcaaacccgggtacaaactgtgcatgcgcctgcacctgcagttaccaactgctcag
cgctgcgctaattatatatccctctttgtccacaccatgcaaggagagtatgacagccac
ctcccttggcccttccagggtacaatacgccttgcaattcttgatcagtctgaggcacct
gtaaggcaaaaccatgaagagatcatggatgccaaaccagagctgcttgccttccagaga
cccacaatcccacggaacccaaaaggttttggctatgtgacttttatgcatctggaagcc
ctaagacaaagaaccttcattaaggatgatactttactagtacgctgtgaggtctctacc
cgcttcgacatgggcagtctccggagggagggttttcagccacgaagtactgattcgggg
acatag

DBGET integrated database retrieval system