KEGG   Ailuropoda melanoleuca (giant panda): 100483231Help
Entry
100483231         CDS       T01329                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00010  Glycolysis / Gluconeogenesis
aml00053  Ascorbate and aldarate metabolism
aml00071  Fatty acid degradation
aml00280  Valine, leucine and isoleucine degradation
aml00310  Lysine degradation
aml00330  Arginine and proline metabolism
aml00340  Histidine metabolism
aml00380  Tryptophan metabolism
aml00410  beta-Alanine metabolism
aml00561  Glycerolipid metabolism
aml00620  Pyruvate metabolism
aml01100  Metabolic pathways
Module
aml_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100483231 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100483231 (ALDH2)
   00620 Pyruvate metabolism
    100483231 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100483231 (ALDH2)
   00561 Glycerolipid metabolism
    100483231 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100483231 (ALDH2)
   00310 Lysine degradation
    100483231 (ALDH2)
   00330 Arginine and proline metabolism
    100483231 (ALDH2)
   00340 Histidine metabolism
    100483231 (ALDH2)
   00380 Tryptophan metabolism
    100483231 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100483231 (ALDH2)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100483231 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 100483231
NCBI-ProteinID: XP_002913100
Ensembl: ENSAMEG00000013664
UniProt: G1M502
LinkDB All DBs
Position
Un
AA seq 521 aa AA seqDB search
MLRTAALAAAGLGPSLGRRLLSAAATQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPT
INPSTGEVICQVAEGDKEDVDRAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDR
TYLAALETLDNGKPYVTSYLVDLDMVLKCFRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN
IIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLVQVAAGNSNLKRVTLELGGKSPNIIMS
DADMNWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYSEFVERSVARAKSRVVGNPFDSQT
EQGPQVDETQFKKVLGYIKSGKDEGAKLLCGGGAAADRGYFIQPTVFGDVQDSMTIAREE
IFGPVMQILKFKTIEEVIGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVF
GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaccgctgcgctcgctgccgctggcctcgggcccagtctgggccgccgtctc
ctgtcggccgctgccacccaggcggtgccggcccccaaccagcagcctgaagtcttctac
aaccagatcttcataaacaatgagtggcacgatgctgtcagcaagaagacattccccacc
atcaatccatctaccggagaagttatctgtcaggtagctgaaggagacaaggaagacgtg
gacagggcagtaaaggctgcccgggctgccttccagctgggctcaccctggcgccgcatg
gatgcgtctgacaggggccgcctgctgaaccgcctggctgatctgattgagcgggaccgg
acctacctagcagccttggagaccctggataacggcaagccctatgtcacctcctacctg
gtggatctggacatggtcctcaaatgcttccgttattatgctggctgggctgataagtac
cacgggaaaaccattcccattgacggggacttcttcagctatacccgccacgaacccgtc
ggggtgtgtgggcagatcattccgtggaacttcccgctcctgatgcaagcctggaaactg
ggcccagccctggcgaccggaaacgtggttgtgatgaaggtagctgagcagactccgctc
accgccctctatgtggccaacctgattaaggaggccggctttccccctggagtggtcaat
attattcctgggtttggccccacagctggggctgccatcgcctcccatgaggacgtggac
aaagtggccttcacaggttccaccgaggttggccacctagtccaagttgctgcagggaac
agtaacctcaagagagtgaccctggagctgggcggaaagagccccaatatcatcatgtca
gatgcagacatgaactgggctgtggagcaggcccacttcgccctgttcttcaaccagggc
cagtgctgctgtgcgggctcccggacctttgtgcaagaagatgtgtactctgagtttgtg
gagcggagtgttgcccgggccaagtctcgtgtagttgggaacccctttgacagccagact
gagcaggggccgcaggtggacgaaactcagtttaagaaggtccttggttatatcaaatct
gggaaggacgagggggccaagctgctgtgtggcggaggggcggctgctgaccgtggctac
ttcatccagcccactgtgtttggagacgtgcaagacagcatgactatcgccagggaggag
atctttgggccagtgatgcagatcctgaagttcaagaccatagaggaagtcattgggaga
gccaacaattccaagtatgggctggctgcagctgtcttcaccaaggacttggacaaggcc
aattatctgtcccaagccctgcaggctggcactgtgtgggtcaactgctatgatgtgttc
ggggcccagtcaccgtttggtggctacaagatgtctgggagcggccgggagctaggagag
tatgggctgcaggcatacaccgaagtgaaaactgtcacggtcaaagtgcctcagaagaac
tcctga

DBGET integrated database retrieval system