KEGG   Ailuropoda melanoleuca (giant panda): 100483319Help
Entry
100483319         CDS       T01329                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00010  Glycolysis / Gluconeogenesis
aml00051  Fructose and mannose metabolism
aml00052  Galactose metabolism
aml00500  Starch and sucrose metabolism
aml00520  Amino sugar and nucleotide sugar metabolism
aml00524  Neomycin, kanamycin and gentamicin biosynthesis
aml01100  Metabolic pathways
aml01200  Carbon metabolism
aml04066  HIF-1 signaling pathway
aml04910  Insulin signaling pathway
aml04930  Type II diabetes mellitus
aml04973  Carbohydrate digestion and absorption
aml05230  Central carbon metabolism in cancer
Module
aml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aml_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100483319 (HK1)
   00051 Fructose and mannose metabolism
    100483319 (HK1)
   00052 Galactose metabolism
    100483319 (HK1)
   00500 Starch and sucrose metabolism
    100483319 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100483319 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100483319 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100483319 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100483319 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100483319 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100483319 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100483319 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100483319 (HK1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100483319 (HK1)
Membrane trafficking [BR:aml04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100483319 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100483319
NCBI-ProteinID: XP_011232564
Ensembl: ENSAMEG00000017924
LinkDB All DBs
Position
Un
AA seq 922 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQNVHMESEIYDTPENIVH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEGILITWTKKFKASGV
EGMDVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKESLLFEGRITPELLTRGKFKTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVXXXAVAYRLAEQHRQIEETLA
HFRLTKDMLLEVKKRMRAEMDMGLRKQTHEKAVVKMLPSFVRSTPDGTEHGDFLALDLGG
TNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPK
MPLGFTFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLREAIKRREEFDLDVVAVV
NDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGNDGRMCINMEWGAFGDN
GCLDDIRTLYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISET
LKTRGIFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCG
AGMAAVVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMYQTVKELSPKCNVSFLLSED
GSGKGAALITAVGVRLREETSS
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcaccgagctgaaggatgaccaagtcaaa
aagattgacaagtatctctatgccatgcggctctccgatgaaaccctgatagatatcatg
actcgtttcaagaaggagatgaagaatggcctctcccgggattttaatccaacagccaca
gtcaagatgttgccaacgtttgtaaggtccattcctgatggttcagaaaagggagatttc
attgccctggatcttggcgggtcttcctttcgaattctgagggtacaagtgaatcacgag
caaaaccagaatgttcacatggagtccgagatttatgacaccccggagaacatcgtgcat
ggcagtggaagccagctttttgatcacgtggctgagtgcctgggagacttcatggagaaa
aaaaaaatcaaggacaagaaattacctgtgggattcacgttttctttcccctgtcgacag
tccaaaatagacgagggcatcctgataacctggacaaagaaatttaaagcgagcggagtg
gagggaatggatgtggtgaagctgcttaacaaagccatcaagaagcgcggggactacgat
gccaacattgtggccgtggtaaacgacacggtggggaccatgatgacttgtggctacgat
gaccagcagtgtgaagtcggcctcatcatcggcactggcaccaatgcctgctacatggag
gaactgaggcacattgacctggtggaaggcgatgaggggaggatgtgcatcaacacggag
tggggggccttcggcgacgacgggtccctggaagacatccgcaccgagttcgaccgggag
atagaccgtggctctctcaaccctgggaagcagctgtttgagaagatggtcagtggcatg
tacttgggggagctggtgcgactgatcctggtcaagatggccaaggagagcctcttgttt
gaagggcggatcaccccggagctgctcaccagggggaagttcaagaccagcgacgtgtca
gccattgagaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccatccgatgacgactgtatttcagtccagcacgtgtgtaccattgtctcattt
cgctctgccaacctggtggctgcaacgctgggcgccatcttgaaccgccttcgagataac
aagggcacacccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcac
ccacagtattcccggcgtttccacaagactctgaggcgcttggtgcccgactccgatgtg
cgcttcctcctctcggagagcggcagtggcaagggggcggccatggtcacggcggtgnnn
nnnnnngcggtggcctaccgcctggcggagcagcaccggcagatagaggagaccctggcc
cacttccgcctcaccaaggacatgctgctggaggtgaagaagaggatgcgggccgagatg
gatatgggcctgaggaagcagacgcacgagaaggccgtggtcaagatgctaccctccttt
gtccggagcacgccagacgggactgagcatggtgacttcttggcccttgatcttggagga
acaaatttccgtgtcctgctggtgaaaatccgcagtgggaaaaagagaacagtggaaatg
cacaacaagatctatgccattcccattgaaatcatgcagggcactggggaagagctgttt
gaccacatcgtctcctgcatttctgacttcctggactacatggggatcaaaggccccaaa
atgcctctgggcttcacgttctccttcccctgcaagcagacgagcctggatgcgggaatc
ttgatcacctggaccaagggttttaaggcaaccgactgcgtggggcacgatgtagcaaca
ttactaagggaagcgataaaaaggagagaggaatttgacctggacgtggtggctgtggtc
aatgacactgtgggcaccatgatgacctgtgcttacgaggagcctacctgcgaggttgga
ctcatcgtagggaccggcagcaatgcctgctacatggaagaaatgaagaatgtcgagatg
ctggaggggaatgacgggcgcatgtgtatcaacatggagtggggtgcctttggggacaat
gggtgtctagatgatatcagaacactctatgacagactggtggatgaatattctctaaac
gctgggaaacaaaggtacgagaaaatgattagcggtatgtacctgggtgagatcgtccgc
aacatcttgatcgacttcaccaagaagggcttcctcttccgagggcagatctccgagacg
ctgaagacccggggcatctttcagaccaaatacctttcccagattgagagtgaccgatta
gcgctgctccaggtccgggccatcctccagcagctgggcctgaacagcacctgtgacgac
agtatcctggtcaagactgtgtgcggggtggtgtccaagagggccgcgcagctgtgtggt
gcgggcatggctgccgtggtggataagatccgagagaacagagggctggaccacctcaac
gtgactgtgggggtggatggaacactctacaagcttcatccgcacttctccagaatcatg
taccaaaccgtgaaggaactgtcaccaaaatgtaacgtgtccttcctcctgtccgaagac
ggtagcggcaagggggccgccctcatcacggcggtgggcgtccggctccgggaagagacg
agcagctaa

DBGET integrated database retrieval system