KEGG   Ailuropoda melanoleuca (giant panda): 100483462
Entry
100483462         CDS       T01329                                 

Gene name
FLT1
Definition
(RefSeq) vascular endothelial growth factor receptor 1 isoform X1
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04066  HIF-1 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04510  Focal adhesion
aml05202  Transcriptional misregulation in cancer
aml05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100483462 (FLT1)
   04014 Ras signaling pathway
    100483462 (FLT1)
   04015 Rap1 signaling pathway
    100483462 (FLT1)
   04066 HIF-1 signaling pathway
    100483462 (FLT1)
   04020 Calcium signaling pathway
    100483462 (FLT1)
   04151 PI3K-Akt signaling pathway
    100483462 (FLT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100483462 (FLT1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100483462 (FLT1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100483462 (FLT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100483462 (FLT1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100483462 (FLT1)
Protein kinases [BR:aml01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   100483462 (FLT1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase ig Ig_2 V-set VEGFR-2_TMD C1-set Ig_4 Ig_5 Herpes_gE DNA_pol3_beta
Other DBs
NCBI-GeneID: 100483462
NCBI-ProteinID: XP_011232124
Ensembl: ENSAMEG00000002209
UniProt: G1L6D4
LinkDB
Position
7
AA seq 1339 aa
MVSCWDTGVLLCALLGGLLLTGSSSGSKLKGPELSLKGTQHVMQAGQTLHLKCRGEAAHS
WSLPETVRKESKRLNITKSACGRNGKQFCSTFTLNMAQANHTGFYSCKYLSIPASEEKKT
ESTVYIFINDTGRPFLEMHSEIPEIIYMTEGREIVVPCRVTSPNITVTLKKFPFDTLIPD
GKRIIWDSRKGFIIANATYREIGLLTCETTVNGHLYKTNYLTYRQTNNIQDVQISTPSPV
KLLQGHTLTLNCTATTDLNTRVQMTWSYPGETKKRASIRQRIGQRTSIAIVFYSVLVIDK
VQNKDKGLYTCHVKSGPSFRSVNTSVHIYDKAFITAEHQDQHVLETTAGTPLYRLSVKVK
AFPSPEVLWLKDGFPVTEKSPRYLVHGYSLIIKDVAEEDAGDYTTLLAIKQSSVFKNITT
TLIVNVKPQIYEKAVSSFPDPTLYLLGSRQTLTCTVYGIPQPTVTWFWRPCNHSHSKARY
DFCSNEEESLILDPDSNIGNRIESITQRVAIIEGKNKTASTLVVADSRISGIYSCMASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDITWILLQTVKNRTT
HHNISKQNVAITKEEYSVTLNVTIKNVSLEDSGTYACRARNIYTGEEILQKKEVTIRDQE
APRLLRNLSDHAVAISSSTTLDCRATGVPEPRITWFKNHRKIQQEPGIILGPGSSTLFIE
RVTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLF
IRKLKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFG
KVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACT
KQGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPDLEQDKKQRLDS
VTSSESFASSGFQEDKSLSDVEEEEDSDDFYKQPITMEDLISYSFQVARGMEFLSSRKCI
HRDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTK
SDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLKEGMRMRAPEYATPEIYQIMLDCWHK
DPKERPRFAELVEKLGDLLQANVQQDGKDYIPLNAILTGNSGFTYSSPAFSDDFFKEDIS
APKFNLGSSDNVRYVNAFNFMSLERIKTFEELSPNTTSIFDDYQVDSSTLLASPWLKRFT
WAESKPKASMKIDLRVTSKSKESGLSELTQPAFCHAGCVHVHRGRRRFTYDNSELEKKIS
CCSPPPDYNSVVLYSTPPV
NT seq 4020 nt   +upstreamnt  +downstreamnt
atggtcagctgctgggacaccggggtcctgctgtgcgcgctgcttggaggtttgctgctt
acaggatctagttcaggttcaaaattaaaaggtcctgaactgagtttaaaaggcacccag
cacgtcatgcaagcaggccagacactgcatctcaaatgtagaggggaagcagcccattca
tggtctttgcctgaaacagtgagaaaggaaagcaaaaggctgaacatcactaaatctgcc
tgtggaaggaatggcaaacagttctgcagtactttcaccttgaacatggctcaggcaaac
cacactggcttctatagctgcaaatatctatctatacctgcttcagaggagaagaaaaca
gaatctacagtctatatatttattaatgatacaggtagacctttcttagagatgcacagt
gaaatacccgaaattatatatatgactgaaggaagggagatcgtcgtcccctgccgggtc
acgtcacctaacatcactgtgactttaaaaaagtttccctttgataccctgatcccggat
ggaaagcgaataatctgggacagtaggaagggttttataatagcaaatgcaacatacaga
gaaatagggcttctgacctgtgaaacaacagtcaacggacatttgtacaagaccaactat
ctcacctatcgacaaaccaataacatccaagatgtccagataagcactccaagcccggtc
aagttgcttcaaggtcacactcttactctgaactgcactgccaccactgatttgaacacg
agggttcaaatgacctggagttaccccggggagacaaagaagagagcgtctataaggcaa
cggattggccagcgcacttccattgccattgtcttctacagcgttcttgttatcgacaaa
gtacagaacaaagacaaagggctgtatacttgccatgtgaagagtggcccgtcattcaga
tctgttaacacctcagtgcatatatatgataaagcattcatcactgccgagcatcaagac
cagcacgtgctggagaccacagcgggcacgccgttgtacaggctttctgtgaaagtgaag
gcatttccctcgccagaggttctatggttaaaagatggattccccgtgactgagaaatct
cctcgctatttggttcatggctactcgttaattatcaaagatgttgctgaagaagatgca
ggggattacacgaccttgctggccataaagcagtccagtgtgtttaaaaacattaccacc
actttaattgtaaatgtgaaaccccagatctatgaaaaggccgtgtcatcctttccagac
ccgactctctatctcctgggcagcagacagaccctgacttgtacggtttatggtatccct
caacctacagtcacgtggttctggcgtccctgtaaccatagtcattccaaagcaaggtat
gacttttgctccaatgaggaagagtccctaatcctggatcctgacagcaacataggaaac
aggattgaaagcatcactcagcgcgtggcaataatagaaggaaagaataagacggctagc
accttggttgtggctgactctagaatttctggaatctacagttgcatggcttccaataaa
gtagggactgtgggaagaaacataagcttttatatcacagatgtgccaaatggatttcat
gttaacttggaaaaaatgcccacagaaggagaggacctgaaactgtcttgcacagttaac
aagttcttatacagagacattacttggattttgctgcagacagttaaaaaccgaacaacg
catcacaacatcagcaagcaaaatgtggccatcactaaagaagagtactccgtcaccctc
aatgtcaccatcaagaacgtttccctggaagattcaggcacctacgcctgcagagccagg
aacatatacacaggggaagaaatccttcagaagaaagaagttacaattagagatcaggaa
gcgccacgcctcctgcgcaacctcagtgaccacgccgtggccatcagcagctccaccacg
ttagactgccgtgccactggtgtccctgagccgcggataacctggtttaaaaaccaccgc
aaaatacaacaagaacccggaattattttaggaccaggaagcagcacgctgtttattgaa
agagtcacagaagaggatgaaggtgtctatcactgcaaagccaccaaccagaaggggtcc
gtggaaagttctgcatacctcactgttcaaggaacctcagacaagtccaatctggagctc
atcactctgacgtgcacctgtgtggctgcaaccctcttctggctcctgttaacgctcttt
atccgaaaactgaaaaggtcttcttctgaaataaagactgactacctatcaattataatg
gacccagacgaagttcccctggacgagcagtgcgaacgtctcccttatgatgccagcaag
tgggagtttgcccgggagagacttaaactgggcaagtcactcggaagaggggcttttgga
aaagtagttcaagcttctgcatttggcattaagaaatcccccacatgccggaccgtggct
gttaaaatgctgaaagagggggccacagccagcgagtacaaagctctgatgactgagctc
aagatcttgacccacattggccaccatctgaatgtagtcaacctgctgggagcctgtacc
aagcaaggagggcccctgatggtgatcgtcgaatattgcaaatacggaaatctgtccaac
tacctcaagagcaaaagagacttattctttctcaacaaggatgcagcattacacatggag
cctaagaaagaaaaaatggagccagacctggagcaagacaagaaacaaagactagatagt
gtcaccagcagcgagagcttcgcgagctccgggtttcaggaagataaaagtctgagcgat
gttgaggaagaggaggattctgatgatttctacaagcagcccatcactatggaagatctg
atttcttacagttttcaagtggccagaggcatggagtttttgtcttccagaaagtgcatt
catcgggacctggcagcaagaaatattcttttatctgagaacaacgtggtgaagatttgc
gattttggccttgcccgggatatttataagaatcccgattatgtgagaaaaggagatact
cgacttcctctgaagtggatggctcccgaatctatcttcgacaaaatctacagcaccaag
agtgatgtgtggtcttacggagtactgctgtgggaaatcttctccctaggtgggtctcca
tacccgggtgtgcagatggacgaggacttctgcagccgcctgaaggaaggcatgaggatg
agggcccccgaatacgcaactcctgaaatctatcagatcatgttggactgctggcacaaa
gacccaaaagaaaggccaagatttgccgaacttgtggaaaaactaggcgatttgcttcaa
gcaaatgtacaacaggacggtaaagactatatcccactaaatgccatactgacaggaaat
agtgggtttacatactcatctcctgccttctctgatgacttcttcaaggaagatatttca
gctccaaagtttaatttgggaagttctgataatgtcagatacgtgaatgctttcaatttc
atgagcctggagagaatcaaaacctttgaagaactttcaccaaacaccacctctatcttt
gatgattaccaggtggacagtagcactctgctggcctccccctggctgaagcgcttcacc
tgggctgagagcaaacccaaggcctccatgaagattgacttgagagttaccagtaaaagt
aaggagtcggggctttctgagctcacgcagcctgctttctgccatgccgggtgtgtgcac
gtccacagaggccggcgcagatttacgtacgacaactcagagctggaaaagaagatttcg
tgctgctctcctcccccagactacaactcggtggtcttatactccaccccgcctgtctaa

DBGET integrated database retrieval system