KEGG   Ailuropoda melanoleuca (giant panda): 100483472
Entry
100483472         CDS       T01329                                 

Gene name
SERPINE1
Definition
(RefSeq) plasminogen activator inhibitor 1 isoform X2
  KO
K03982  plasminogen activator inhibitor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04066  HIF-1 signaling pathway
aml04115  p53 signaling pathway
aml04218  Cellular senescence
aml04371  Apelin signaling pathway
aml04390  Hippo signaling pathway
aml04610  Complement and coagulation cascades
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100483472 (SERPINE1)
   04371 Apelin signaling pathway
    100483472 (SERPINE1)
   04066 HIF-1 signaling pathway
    100483472 (SERPINE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100483472 (SERPINE1)
   04218 Cellular senescence
    100483472 (SERPINE1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100483472 (SERPINE1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100483472 (SERPINE1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100483472 (SERPINE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100483472 (SERPINE1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100483472 (SERPINE1)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100483472 (SERPINE1)
Peptidases and inhibitors [BR:aml01002]
 Peptidase inhibitors
  Family I4: serpin family
   100483472 (SERPINE1)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100483472 (SERPINE1)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   100483472 (SERPINE1)
SSDB
Motif
Pfam: Serpin LexA_DNA_bind
Other DBs
NCBI-GeneID: 100483472
NCBI-ProteinID: XP_002930644
Ensembl: ENSAMEG00000002621
UniProt: D2I5Z6
LinkDB
Position
10
AA seq 402 aa
MQMSPVFVCLALGLALIFGEASASDPRQTQVAQLATDFGVKVFQQVARASKDRNVVFSPY
GVASVLAMLQLTTAGETQQQIQEAMQFQIDKKGMAPALRQLYKELMGPWNKDEISTADAI
FVQRDLKLVHGFMPHFFRLFRTTVKQVDFSEVERARFIVNDWVKRHTKGMIGNLLGRGAV
DQLTRLMLVNALYFNGHWKTPFPKSGTHHRLFHKSDGSTVSVPMMAQTNKFNYTEFLTPD
GHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILDAQLISQWKGNMTRRLRLLVLPK
LSLESEVDLRRPLENLGMTDMFRPNQADFSSLSDQEALYVSQALQKVKIEVNESGTVASS
STAIIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgcagatgtctccggtctttgtctgcctagccctgggcctggccctcatctttggtgaa
gcgtcggcctcagacccccgccagactcaggtggcacaactggccacagactttggagtg
aaggtgtttcagcaggtggcgcgggcctccaaggaccgcaacgtggttttctccccctat
ggggtggcctcagtcctggccatgttgcagctgacaacagcaggagagacccagcagcag
attcaagaggccatgcaattccagattgacaagaagggcatggcacctgccctccgccaa
ctgtacaaggaactcatggggccgtggaacaaggatgagatcagcactgcagatgccatc
tttgtccagcgggatctgaagctggtccacggcttcatgccccacttcttcaggctcttc
cggaccacagtcaagcaggtggacttctccgaggtggagagagccaggttcatcgtaaac
gactgggtgaagagacacacaaaaggcatgattggcaacttactgggcagaggggccgtg
gaccagctgacgcgcctgatgctggtgaacgccctgtacttcaacggccactggaagacc
cccttccccaagtcgggtacccaccaccgcctcttccacaaatctgatggcagcaccgtc
tctgtgcccatgatggctcagaccaacaagttcaactacaccgagtttttgacccccgac
ggccattactacgacatcctcgaactgccctaccacggggacactctcagcatgttcatc
gctgctccctatgaaaaggaggtgcccctctctgctctcaccaacatcctggatgcccag
ctcatcagccagtggaaagggaatatgaccaggcggctccgcctcttggttctgcccaag
ctctccctggagagtgaagtcgacctccggcggcccctggagaacctggggatgactgac
atgtttaggccaaaccaggcagacttctcgagtctttcagatcaagaggcactgtatgtg
tcgcaggctttgcaaaaagtgaagatcgaggtgaatgagagcggcacggtggcgtcctcg
tctacagccatcatcgtctcagcccgaatggcccccgaggagatcatcatggacagaccc
ttcctctttgtggtgcggcacaaccccacaggaacggtccttttcatgggccaagtgatg
gaaccctga

DBGET integrated database retrieval system