KEGG   Ailuropoda melanoleuca (giant panda): 100483760
Entry
100483760         CDS       T01329                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml04115  p53 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04370  VEGF signaling pathway
aml04919  Thyroid hormone signaling pathway
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05014  Amyotrophic lateral sclerosis
aml05016  Huntington disease
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05134  Legionellosis
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100483760 (CASP9)
   04151 PI3K-Akt signaling pathway
    100483760 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100483760 (CASP9)
   04215 Apoptosis - multiple species
    100483760 (CASP9)
   04115 p53 signaling pathway
    100483760 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100483760 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100483760 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100483760 (CASP9)
   05212 Pancreatic cancer
    100483760 (CASP9)
   05215 Prostate cancer
    100483760 (CASP9)
   05213 Endometrial cancer
    100483760 (CASP9)
   05222 Small cell lung cancer
    100483760 (CASP9)
   05223 Non-small cell lung cancer
    100483760 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100483760 (CASP9)
   05012 Parkinson disease
    100483760 (CASP9)
   05014 Amyotrophic lateral sclerosis
    100483760 (CASP9)
   05016 Huntington disease
    100483760 (CASP9)
   05020 Prion disease
    100483760 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    100483760 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100483760 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100483760 (CASP9)
   05152 Tuberculosis
    100483760 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100483760 (CASP9)
   05161 Hepatitis B
    100483760 (CASP9)
   05160 Hepatitis C
    100483760 (CASP9)
   05164 Influenza A
    100483760 (CASP9)
   05162 Measles
    100483760 (CASP9)
   05168 Herpes simplex virus 1 infection
    100483760 (CASP9)
   05163 Human cytomegalovirus infection
    100483760 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100483760 (CASP9)
   05169 Epstein-Barr virus infection
    100483760 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100483760 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100483760 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100483760 (CASP9)
   01002 Peptidases and inhibitors [BR:aml01002]
    100483760 (CASP9)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100483760 (CASP9)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100483760 (CASP9)
Peptidases and inhibitors [BR:aml01002]
 Cysteine peptidases
  Family C14: caspase family
   100483760 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD adh_short_C2
Other DBs
NCBI-GeneID: 100483760
NCBI-ProteinID: XP_002921477
Ensembl: ENSAMEG00000011912
LinkDB
Position
11
AA seq 413 aa
MIEDIQHAGSGSRSDQARQLVIDLETRGSQALPLFISCLEDTDQDKLASLLRMSRQAEKQ
NPEAVRPLNLMPVVLRPTALTPEDLREKHGPSKPTPGKLAPVVLGPEQLWPDKLRPEVLR
PEVSRPVDNGSGRFSDVCAQEISKQNVDLAYALNADPCGHCLIINNVNFRLESRLTARTG
SNIDCEKLHRRFRLLHFTVEVKCDLTAKQMVQALVELARRDHGALDCCVVVVLSHGCQAS
HRQFPGAVYGTDGCPVSIEKIVNIFNGAGCPSLGGKPKLFFIQACGGEQKDHGFQVASAS
PEDRTPDSDPKSDAVPFQEGPGPFDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTKSGSW
YVETLDGVFEQWADSEDLQTLLLRVANAVSQKGIYKQIPGCFNFLRKKLFFKT
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgatcgaggacattcagcatgcaggctcagggtctcggagcgatcaggccaggcagctg
gtcatagatctagagacccgagggagtcaggccctccctttgttcatctcctgcttagaa
gacacagaccaggataagctggcttcattgctgagaatgagtcggcaagcagaaaagcag
aatccagaggctgtcagacccctgaacctcatgcctgtggtgcttagaccaacggccctc
acaccagaggatctcagagagaagcacggtccatcaaagccaactccaggaaaactcgct
ccagtggtgctggggcctgagcagctctggccagacaagctcaggccagaggttctcaga
ccagaggtctccaggccagtggacaatggttctggacgattcagtgatgtctgtgctcag
gagatttccaagcaaaatgttgatttggcgtatgccctgaacgcagacccctgcggccac
tgcctcatcatcaacaacgtgaacttccgcctcgagtcgaggctcacggcccgcaccggc
tccaatatcgactgcgaaaagctgcatcggcgcttccgcttgctgcatttcacggtggag
gtgaagtgcgacctgacggccaagcaaatggtccaggctttggtggagctggcgcggcgc
gaccacggtgcccttgactgctgcgtggtggtcgtcctctctcacggctgtcaggccagc
caccgccagttcccaggggctgtttatggcacggatggatgtcctgtgtccatcgagaaa
attgtgaacatcttcaatggagccggctgccccagcttgggagggaagcccaagcttttc
ttcatccaggcctgtggtggggagcagaaagaccatggatttcaggtggcctctgcttcc
cctgaagacaggacccctgacagtgaccccaagtccgacgctgtcccgttccaggaaggc
ccagggccctttgaccagccggacgccgtgtctagtttgcccacacccagtgacatcttt
gtgtcctactccactttcccaggctttgtttcctggagggataccaagagcggctcctgg
tacgtggagaccttggacggtgtttttgagcagtgggctgactcggaggacctgcagacc
ctcctgctcagggtcgctaatgctgtttcgcagaaagggatttacaaacagattcctggt
tgtttcaatttcctccggaaaaaacttttttttaaaacataa

DBGET integrated database retrieval system