KEGG   Ailuropoda melanoleuca (giant panda): 100483785
Entry
100483785         CDS       T01329                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04066  HIF-1 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04630  JAK-STAT signaling pathway
aml04640  Hematopoietic cell lineage
aml05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100483785 (EPO)
   04066 HIF-1 signaling pathway
    100483785 (EPO)
   04151 PI3K-Akt signaling pathway
    100483785 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100483785 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100483785 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100483785 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100483785 (EPO)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  CSF and other factors
   100483785 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100483785
NCBI-ProteinID: XP_011233138
Ensembl: ENSAMEG00000014713
LinkDB
Position
10
AA seq 192 aa
MGACECPALLLLLSLLLLPLGLPVLGAPPRLICDSRVLERYILEAREAENVTMGCAQGCS
FSENITVPDTKVNFYTWKRMDVGQQALEVWQGLALLSEAILRGQALLANSSQPSETLRLH
VDKAVSSLRSLTSLLRALGAQKEAISLPEEASAAPLRTFTVDTLCKLFRIYSNFLRGKLT
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggcgtgcgaatgtcctgccctgctgcttctgctgtccttgctgctgcttcctctg
ggcctcccagtcctgggcgccccccctcgcctcatttgtgacagccgagtcctggagagg
tacatcctggaggccagggaggccgaaaatgtcacgatgggctgtgctcaaggttgcagc
ttcagtgagaatatcaccgtcccagacaccaaggttaatttctacacctggaaaaggatg
gatgtcgggcagcaggccttggaagtctggcagggcctggccctgctctcagaagccatc
ctgcggggccaggccctgttggccaactcctcgcagccgtctgagaccctgcggctgcat
gtggacaaagccgtcagcagcctgcgcagcctcacctccctgcttcgggcgctcggagcc
cagaaggaggccatctcccttccagaggaagcctctgctgctccactccgaacattcact
gttgatactttgtgcaaacttttccgaatctactccaatttcctgcggggaaagctgacg
ctgtacacaggggaggcctgtaggagaggggacaggtga

DBGET integrated database retrieval system