KEGG   Ailuropoda melanoleuca (giant panda): 100483834
Entry
100483834         CDS       T01329                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04024  cAMP signaling pathway
aml04137  Mitophagy - animal
aml04210  Apoptosis
aml04310  Wnt signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04530  Tight junction
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04912  GnRH signaling pathway
aml04915  Estrogen signaling pathway
aml04921  Oxytocin signaling pathway
aml04926  Relaxin signaling pathway
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05161  Hepatitis B
aml05162  Measles
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05224  Breast cancer
aml05231  Choline metabolism in cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05321  Inflammatory bowel disease
aml05323  Rheumatoid arthritis
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100483834 (JUN)
   04012 ErbB signaling pathway
    100483834 (JUN)
   04310 Wnt signaling pathway
    100483834 (JUN)
   04668 TNF signaling pathway
    100483834 (JUN)
   04024 cAMP signaling pathway
    100483834 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100483834 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    100483834 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100483834 (JUN)
   04530 Tight junction
    100483834 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100483834 (JUN)
   04621 NOD-like receptor signaling pathway
    100483834 (JUN)
   04625 C-type lectin receptor signaling pathway
    100483834 (JUN)
   04660 T cell receptor signaling pathway
    100483834 (JUN)
   04658 Th1 and Th2 cell differentiation
    100483834 (JUN)
   04659 Th17 cell differentiation
    100483834 (JUN)
   04657 IL-17 signaling pathway
    100483834 (JUN)
   04662 B cell receptor signaling pathway
    100483834 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100483834 (JUN)
   04915 Estrogen signaling pathway
    100483834 (JUN)
   04921 Oxytocin signaling pathway
    100483834 (JUN)
   04926 Relaxin signaling pathway
    100483834 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100483834 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100483834 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100483834 (JUN)
   05203 Viral carcinogenesis
    100483834 (JUN)
   05231 Choline metabolism in cancer
    100483834 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100483834 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100483834 (JUN)
   05211 Renal cell carcinoma
    100483834 (JUN)
   05224 Breast cancer
    100483834 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100483834 (JUN)
   05321 Inflammatory bowel disease
    100483834 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    100483834 (JUN)
   05031 Amphetamine addiction
    100483834 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100483834 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100483834 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100483834 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100483834 (JUN)
   05135 Yersinia infection
    100483834 (JUN)
   05133 Pertussis
    100483834 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100483834 (JUN)
   05170 Human immunodeficiency virus 1 infection
    100483834 (JUN)
   05161 Hepatitis B
    100483834 (JUN)
   05171 Coronavirus disease - COVID-19
    100483834 (JUN)
   05162 Measles
    100483834 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100483834 (JUN)
   05169 Epstein-Barr virus infection
    100483834 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100483834 (JUN)
   05142 Chagas disease
    100483834 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100483834 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100483834 (JUN)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100483834 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N TFIIA
Other DBs
NCBI-GeneID: 100483834
NCBI-ProteinID: XP_019653006
LinkDB
Position
2
AA seq 334 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggatctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccactacgccgacccccacgcagttcctgtgcccc
aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg
ggcatggtggctccggcggtggcttcggcggcgggcggcagcggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcag
ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagatccccgtg
cagcacccgcggcttcaggccttgaaggaggagccgcagacggtgcccgagatgcccggg
gaaacgcctcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcagagagg
aagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatc
gccaggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system