KEGG   Ailuropoda melanoleuca (giant panda): 100484237
Entry
100484237         CDS       T01329                                 

Gene name
SRF
Definition
(RefSeq) serum response factor isoform X1
  KO
K04378  serum response factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04022  cGMP-PKG signaling pathway
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100484237 (SRF)
   04022 cGMP-PKG signaling pathway
    100484237 (SRF)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100484237 (SRF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100484237 (SRF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100484237 (SRF)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box responders to external signals
    100484237 (SRF)
SSDB
Motif
Pfam: SRF-TF
Other DBs
NCBI-GeneID: 100484237
NCBI-ProteinID: XP_011217091
Ensembl: ENSAMEG00000012452
LinkDB
Position
19
AA seq 507 aa
MLPSQAGAAAALGRGSALGGSLNRTPTGRPGGGGGGGTRGANGGRVPGNGAGLGPGRLER
EAAAAATTTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMELVGGPEAAAAAT
GGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGT
QVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGF
EETDLTYQVSESDSSGETKDTLKQAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITN
YLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAIQ
VHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPTS
GLADGSLTVLNAFPQAPSTMQVSHSQVQEQGGVPQVFLTAPSGTVQIPVSAVQLHQMAVI
GQQAGSSSNLTELQVVNLDAAHSTKSD
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgttaccgagccaagctggggccgcggcggcgctgggccggggctcggctctggggggc
agcctgaaccggaccccgacggggcggccgggaggtggcggcggcggcgggactcgcggg
gctaacgggggccgggttcccgggaacggcgcggggctcgggccgggccgcctcgagagg
gaggctgcagcagcagcgacaaccaccccggcgcccaccgcgggggccctctacagcggc
agcgagggcgactcggagtcgggagaggaggaggagctgggcgcggagcggcgcggcctg
aagcggagcctcagcgagatggagctcgtcggtgggcccgaggcggcggcggcggccacc
ggaggctatgggccggtgagtggcgcggtgagcggggccaagccgggtaagaagactcgg
ggccgcgtgaagatcaagatggagttcatcgacaacaaactgcggcgctacacgaccttc
agcaagaggaagacgggcatcatgaagaaggcctatgagctgtccacgctgacagggaca
caggtgctgttgctggtggccagtgaaacaggccatgtgtatacctttgccacccgcaaa
ctgcagcccatgatcaccagtgagactggcaaggcactgattcagacctgcctcaactcg
ccagactctccaccccgctcagaccccaccacagaccagagaatgagtgccacgggcttt
gaagagacagacctcacctaccaggtgtcggagtccgacagcagtggggagaccaaggac
acgctgaaacaggcgttcacggtcaccaacctgccgggtaccacctccaccatccaaaca
gcacccagcacctctaccaccatgcaagtcagcagtggcccctccttccccatcacaaac
tacctggcaccggtgtctgctagcgtcagccccagcgctgtcagcagtgccaatgggact
gtgctgaagagtacaggcagcggcccggtctcctctgggggcctcatgcagctgcccacc
agcttcaccctcatgcctggtggggcagtggcccagcaggtcccagtgcaggccattcag
gtgcaccaggccccacagcaagcgtctccctctcgcgacagcagcacagacctcacgcag
acctcctccagcgggacagtgacattgcctgccaccatcatgacgtcatctgtgcccaca
actgtgggtggccacatgatgtaccctagtccccatgcggtgatgtatgcacccacctcg
ggcttggctgatggcagcctcaccgtgctcaatgccttcccccaggcgccatccaccatg
caggtgtcccacagccaggtccaggagcaaggtggcgttccccaggtgttcttgaccgcg
ccgtctgggacagtgcagatccctgtgtctgcggtgcagcttcaccagatggctgtgata
gggcagcaggctgggagcagcagcaacctcaccgagttacaggtggtgaacctggatgcc
gcccacagcaccaagagtgactga

DBGET integrated database retrieval system