KEGG   Ailuropoda melanoleuca (giant panda): 100484463Help
Entry
100484463         CDS       T01329                                 

Gene name
PCSK1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aml01002]
    100484463 (PCSK1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aml03110]
    100484463 (PCSK1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100484463 (PCSK1)
Peptidases [BR:aml01002]
 Serine Peptidases
  Family S8: subtilisin family
   100484463 (PCSK1)
Chaperones and folding catalysts [BR:aml03110]
 Intramolecular chaperones
  Subtilisin family
   100484463 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert OmpA_membrane Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 100484463
NCBI-ProteinID: XP_002926469
Ensembl: ENSAMEG00000018229
UniProt: D2HUX9
LinkDB All DBs
Position
Un
AA seq 753 aa AA seqDB search
MERRAWTLQRTAFALFCAWCALNSVKAKKQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSVLRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYEN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
DNNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWTSVPEKKECVVKDNDFEPRALK
GNGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDLGEEESTQENLKKNPLVSKSLSGSSSEGRRDELVE
AAPSEAMLRLLQSAFSKNSIPKQSPKKSPSAKLHIPYENFYEALEKLNKPSQLKDSEDSL
YSDYVDVFYNTKPYKHRDDRLLQALVDILREEN
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggagagaagagcctggactctgcagcgtactgctttcgctctcttttgcgcttggtgt
gcactgaacagtgtaaaagcgaagaagcagtttgtgaatgaatgggcggcagaaatcccc
gggggaccggaggcagcttcggccatagcggaggagctgggctatgaccttttgggtcag
attggatcacttgaaaatcattacttattcaaacataaaaaccatccccgaaggtctcga
aggagtgcctttcatattactaagagattatctgatgatgatcgtgtaatatgggctgaa
caacagtatgaaaaagagagaagtaaacgttcagttttaagagactcagcactaaatctc
ttcaatgatccaatgtggaatcagcagtggtacttgcaagatactaggatgactgcagcc
ctgcccaagctggatctccatgtgatacctgtttggcaaaaaggcatcacaggcaaagga
gttgttatcacagtactggacgatggcttggagtggaatcacacagacatctatgaaaat
tatgatccagaggctagttatgattttaacgataatgaccatgatccatttccccgttat
gatcccacaaatgagaacaaacatgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaagtgtggggtcggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgactgacgctattgaagccagttcaattggattcaatcccggacat
gtggacatttacagtgccagctggggccctaatgatgatgggaaaaccgtggaggggcct
ggccgactggcccagaaggcttttgaatatggtgtcaagcaggggagacaaggaaagggc
tccatcttcgtgtgggcttctgggaacgggggacgtcagggcgataactgtgactgcgac
ggctacacggacagcatctacaccatctccatcagcagcgcctcacagcaaggcttgtcc
ccctggtatgctgagaagtgctcctccaccctggccacctcgtacagcagcggggattac
accgaccagcgaatcacaagcgctgacctgcacaatgactgcacagagacccacacgggc
acctcggcctcggcacccctggctgctggcatcttcgctctggcgctggaagcaaatcca
aatctcacttggcgagacatgcaacacttggttgtctggacctctgagtatgacccactg
gacaataaccctggatggaaaaagaatggagcaggcttgatggtgaatagtcgatttgga
tttgggttgctaaatgccaaagctctggtggatttagctgatcccaggacctggaccagt
gtgcccgagaagaaagagtgtgtggtaaaggacaatgactttgagcccagagccctgaaa
ggtaatggagaagttatcattgaaattccaacaagagcttgtgaaggacaagaaaatgcc
atcaagtccctggaacatgtgcaatttgaagcaacgattgaatattcccgaagaggagac
cttcatgttacactcacttctgctgctgggaccagcactgtactgttggctgaaagagag
cgggatacatctcctaacggctttaagaattgggacttcatgtctgttcacacgtgggga
gagaatcccataggcacttggactttgcgaattacagacatgtctggaagaatgcaaaat
gaaggaagaattgtcaactggaagctgattttgcatggcacctcatctcagccagaacac
atgaaacagccccgtgtgtacacatcctataacaccgttcagaatgacagaagaggggtg
gagaagatggtggatctgggggaggaggagtccacacaagagaacctgaaaaagaacccc
cttgtgtcaaaaagtctcagtggcagcagttcagagggcagaagggatgagctggtggag
gcagccccatctgaggctatgctgagactcctacaaagtgctttcagcaaaaactcaatc
ccaaagcaatcaccaaagaagtctccgagtgcaaagctccacatcccttatgaaaatttc
tatgaagccctggaaaagctgaacaagccttcccagcttaaagactctgaggacagtcta
tacagcgactatgttgatgttttctataacacgaaaccttacaagcacagagatgaccgg
ctgctgcaggctctggtggacattctgagggaagaaaattga

DBGET integrated database retrieval system