KEGG   Ailuropoda melanoleuca (giant panda): 100484750
Entry
100484750         CDS       T01329                                 

Gene name
FOSL1
Definition
(RefSeq) fos-related antigen 1 isoform X1
  KO
K04502  fos-like antigen 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml04380  Osteoclast differentiation
aml04657  IL-17 signaling pathway
aml05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100484750 (FOSL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100484750 (FOSL1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100484750 (FOSL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100484750 (FOSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100484750 (FOSL1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100484750 (FOSL1)
SSDB
Motif
Pfam: bZIP_1 bZIP_Maf bZIP_2 DUF3450 Macoilin ASD2 Siah-Interact_N HALZ TMCO5 UPF0242 DUF4407 DUF4527
Other DBs
NCBI-GeneID: 100484750
NCBI-ProteinID: XP_002916671
Ensembl: ENSAMEG00000017284
LinkDB
Position
16
AA seq 271 aa
MFRDFGEPGPSSGAGGAYGGPAQPPTSGQQKFHPVPSIHAVSGSQELQWMVQPHFLGPSS
YPRPLAYSQYSPPQPRPGVIRALGPHPGVHRRPCEQISPEEEERRRVRRERNKLAAAKCR
NRRKELTDFLQAETDKLEDEKSSLQREIEELQKQKERLELVLEAHRPICKIPEGATESDT
GGTGGTSSTSSPPAPSRPVPCISLSSGPVLEPEALHTPTLMTTPSLTPFTPSPVFTYPST
PEPCSSAHRRSSSSSGDPSSDPLGSPTLLAL
NT seq 816 nt   +upstreamnt  +downstreamnt
atgttccgagactttggggaacccggaccgagctccggggccggcggtgcgtacggcggc
ccggcgcagccccccacttcaggccagcagaagttccaccccgtgccgagcatccacgct
gtgagtggcagccaggagctacagtggatggtgcagcctcacttcctgggacccagcagt
taccccaggcctctggcctactcccagtacagccccccgcagccccggccaggcgtcatc
cgggccctagggccacatccaggggtgcatcgccggccctgtgaacagatcagcccggag
gaggaggagcgccgtcgagtgaggcgtgagcggaataagctggccgcggccaagtgcagg
aaccggaggaaggaactgaccgacttcctacaggcggagactgacaaactggaggacgag
aaatccagtctgcaacgagagattgaggagctgcagaagcagaaggagcgcctggagctg
gtccttgaagcccaccgccccatctgcaaaatcccggaaggggccacggagagcgacact
ggcggcacgggcggtaccagcagcaccagcagcccaccagccccctcccgccctgtacct
tgtatctctctttcctcggggcctgtgcttgaacccgaagcattgcacaccccgacgctc
atgaccacaccctccctgactcctttcacccctagtcccgtcttcacctaccccagcacc
cctgagccctgctcctcagcccatcgcaggagtagcagcagcagcggggacccatcctct
gaccctctcggctcccccacactccttgccttatga

DBGET integrated database retrieval system