KEGG   Ailuropoda melanoleuca (giant panda): 100484923
Entry
100484923         CDS       T01329                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04012  ErbB signaling pathway
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04218  Cellular senescence
aml04630  JAK-STAT signaling pathway
aml04921  Oxytocin signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing syndrome
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100484923 (CDKN1A)
   04630 JAK-STAT signaling pathway
    100484923 (CDKN1A)
   04066 HIF-1 signaling pathway
    100484923 (CDKN1A)
   04068 FoxO signaling pathway
    100484923 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100484923 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100484923 (CDKN1A)
   04115 p53 signaling pathway
    100484923 (CDKN1A)
   04218 Cellular senescence
    100484923 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100484923 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100484923 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100484923 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100484923 (CDKN1A)
   05206 MicroRNAs in cancer
    100484923 (CDKN1A)
   05205 Proteoglycans in cancer
    100484923 (CDKN1A)
   05203 Viral carcinogenesis
    100484923 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100484923 (CDKN1A)
   05212 Pancreatic cancer
    100484923 (CDKN1A)
   05225 Hepatocellular carcinoma
    100484923 (CDKN1A)
   05226 Gastric cancer
    100484923 (CDKN1A)
   05214 Glioma
    100484923 (CDKN1A)
   05216 Thyroid cancer
    100484923 (CDKN1A)
   05220 Chronic myeloid leukemia
    100484923 (CDKN1A)
   05217 Basal cell carcinoma
    100484923 (CDKN1A)
   05218 Melanoma
    100484923 (CDKN1A)
   05211 Renal cell carcinoma
    100484923 (CDKN1A)
   05219 Bladder cancer
    100484923 (CDKN1A)
   05215 Prostate cancer
    100484923 (CDKN1A)
   05213 Endometrial cancer
    100484923 (CDKN1A)
   05224 Breast cancer
    100484923 (CDKN1A)
   05222 Small cell lung cancer
    100484923 (CDKN1A)
   05223 Non-small cell lung cancer
    100484923 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100484923 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100484923 (CDKN1A)
   05161 Hepatitis B
    100484923 (CDKN1A)
   05160 Hepatitis C
    100484923 (CDKN1A)
   05163 Human cytomegalovirus infection
    100484923 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100484923 (CDKN1A)
   05169 Epstein-Barr virus infection
    100484923 (CDKN1A)
   05165 Human papillomavirus infection
    100484923 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100484923 (CDKN1A)
   01522 Endocrine resistance
    100484923 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100484923
NCBI-ProteinID: XP_002914333
Ensembl: ENSAMEG00000000266
LinkDB
Position
5
AA seq 164 aa
MAEPSGDAQQVPRGSKACRRLFGPVDSEQLRRDCDALMAGCVQEARERWNFDFVTETPLE
GDFAWERVWGLGLPKLYLPAGPCGGRDDLGGGKRPSPSPALLQGTAQEDHLDLSLSCTLM
PHAPERPEASPGAPGTSQGRRRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcagagccatccggggacgcccagcaggtcccgcgtggcagcaaggcttgccgccgc
ctcttcggccccgtggacagcgagcagctgcgccgagactgcgatgcgctgatggcgggc
tgcgtgcaggaggcccgggagcgatggaacttcgactttgtcaccgagacaccgctggag
ggcgactttgcctgggagcgcgtgtggggcctgggcctgcccaagctctacctgcctgcg
gggccctgtgggggccgggatgacctgggagggggcaagcggcccagcccctcgcctgcc
ctgctgcaggggaccgctcaggaggaccacctggacctgtcgctgtcctgcaccctcatg
cctcacgcccctgagcggcccgaggcgtccccgggggcgcctggcacctctcagggccgg
agacggaggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctcc
aaaaggaagccctga

DBGET integrated database retrieval system