KEGG   Ailuropoda melanoleuca (giant panda): 105234697
Entry
105234697         CDS       T01329                                 

Gene name
MAD1L1
Definition
(RefSeq) mitotic spindle assembly checkpoint protein MAD1 isoform X5
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04914  Progesterone-mediated oocyte maturation
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105234697 (MAD1L1)
   04114 Oocyte meiosis
    105234697 (MAD1L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    105234697 (MAD1L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105234697 (MAD1L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105234697 (MAD1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    105234697 (MAD1L1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     105234697 (MAD1L1)
SSDB
Motif
Pfam: MAD
Other DBs
NCBI-GeneID: 105234697
NCBI-ProteinID: XP_019660263
LinkDB
Position
10
AA seq 317 aa
MQSSMLERDGMRAILGSYDSELTAAEYSPQLTRRMREAEDMVQKVHAHSSEMEAQLSQAL
EELGGQKQRADMLEMEVKMLQSQSSAAEQSFPLSREEASSLRLKIEELEGERSRLEEDKK
TLEMQLERFTLQGSYDQSRTKVLHMSMNPASAAKQRLREDQAQLQEECKQLRELVHALER
GGPIPADLEAVASLPSSKELTELRKQVESAELKNQRLKEVFQTKIQEFRKVCYALTGYQI
DITTENQYRLTSMYAEHKADCLIFKATGPSGTKMQLLETAFSHTVQELIELHLLRQDSIP
AFLSALTLDLFSRQTVA
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcagagctccatgctggagcgggacggaatgcgcgccatcctgggttcctacgacagc
gagctgaccgcggccgagtactcgccccagctgacacgtcgcatgcgtgaggccgaggac
atggtgcagaaggtgcacgcacacagctcagagatggaggctcagctgtcacaggccctg
gaggagctgggaggccagaagcagagagcggacatgctggagatggaggtgaagatgttg
cagtctcagtccagcgccgctgagcagagcttcccactgtccagggaggaggcgagctca
ctcaggttgaagattgaggagctggaaggggagcgcagtcgtctggaagaagacaagaag
acgctggaaatgcagctcgagcggtttaccctgcagggcagctacgaccagagcagaacc
aaagtgctgcacatgagcatgaacccggccagcgcagccaagcagcggctccgtgaggac
caggcccaactgcaggaggagtgcaagcagctgcgggagctcgtgcacgccctggagcga
ggtggccccatccctgccgacctggaggccgtcgcgagtctgccttcgtccaaggagctg
acagagctgaggaagcaggtggagagcgctgagctgaagaaccagcggctcaaggaggtc
tttcaaaccaagatccaggagttccgcaaagtctgctacgcgctcacgggctaccagatc
gacatcacgacggagaaccagtaccggctgacgtccatgtacgcggagcacaaagctgac
tgcctcatcttcaaggccacgggaccctcgggcaccaagatgcagctgctggagacggcg
ttctcgcacacggtgcaggagctcatcgagctgcacctgctgcggcaggacagcatcccg
gccttcctcagcgctctcaccctcgacctcttcagccgccagaccgtggcctag

DBGET integrated database retrieval system