KEGG   Ailuropoda melanoleuca (giant panda): 105235627
Entry
105235627         CDS       T01329                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05200  Pathways in cancer
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105235627 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    105235627 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    105235627 (NKX3-1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    105235627 (NKX3-1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 105235627
NCBI-ProteinID: XP_034517145
LinkDB
Position
5
AA seq 231 aa
MLRAPEPRPREAGAANQSKPLTSFLIQDILRDGAERRGGHTSSPQPPLRPDPRRDQEPEP
ERGRGGAGAPEDEWRARPRAAQEADAPAESEPDRHFETYLLDCENSAGSLPSLPQTSKQP
QKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQ
LTSDLGDLEKHSSLPALKEEGLSQASPISMHNSYPYYPYLYCLGGWNPPFW
NT seq 696 nt   +upstreamnt  +downstreamnt
atgctcagggctcccgagccgcggcccagggaggcgggggcggccaaccagtccaagccg
ctcacctccttcctcatccaggacatcctgcgggacggcgcggagaggcgcggcggccac
acaagcagcccgcagcccccgctccggccggacccgcggcgagaccaggagccggagccc
gagcgaggaagaggcggcgccggggcgcccgaggacgagtggagagcccggccccgcgcc
gcgcaggaggccgacgcgccggcggagagcgagccagatagacactttgagacttatctg
ttggactgtgaaaacagtgcaggctccttaccaagccttccgcaaacctcgaaacagcca
cagaagcgctcccgtgccgccttctcccacactcaggtcattgagttagagaggaaattc
agccaccagaagtatctgtcagcccctgaaagggctcacctggccaagaacctcaagctc
actgagacccaggtgaaaatatggttccagaacagacgctataagaccaagcgaaagcag
ctcacctcggacctgggagacctggagaagcactcctccctgccggctctgaaagaggag
ggcttatcccaggcctcccccatctccatgcataacagctacccttactacccctacctg
tactgcttgggaggctggaacccacctttctggtaa

DBGET integrated database retrieval system