KEGG   Ailuropoda melanoleuca (giant panda): 105236609
Entry
105236609         CDS       T01329                                 

Gene name
FRAT1
Definition
(RefSeq) proto-oncogene FRAT1
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04310  Wnt signaling pathway
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05200  Pathways in cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105236609 (FRAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105236609 (FRAT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105236609 (FRAT1)
   05226 Gastric cancer
    105236609 (FRAT1)
   05224 Breast cancer
    105236609 (FRAT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105236609 (FRAT1)
   05022 Pathways of neurodegeneration - multiple diseases
    105236609 (FRAT1)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 105236609
NCBI-ProteinID: XP_034519504
LinkDB
Position
6
AA seq 172 aa
GALRCALGDRGRVRGRAAPYFVAELAAGPSALSPLALQPGLDGPSGADKRGAPQPLSGPC
RRGWLRGAAASRRLQQRRGPQPESRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLH
AKLPQRPLSGPLSAPVHEPPSPRSPRAACSDPAASGRRAQLRTGDGVLVPGS
NT seq 519 nt   +upstreamnt  +downstreamnt
ggggccctgcgctgcgccctcggggaccgcggccgcgtgcggggccgggctgcgccctac
ttcgtggccgagctcgccgcaggccccagcgcgctgtctccactggcccttcagcccggc
cttgacgggccttcgggagcggacaaacggggcgccccgcagccactgtcgggcccgtgc
cggcgaggttggctgcggggcgccgccgcctcccgccgcctgcaacagcgccgcgggccc
cagcccgaatcccgcaccggcgacgacgacccgcaccggctcctgcagcagctggtgctc
tcggggaacctcatcaaggaggccgtgcggaggcttcattcgagacggctgcagttacac
gcaaagcttccccaacgcccgctctccgggcctctgtcggccccagtgcatgagccccct
tcgccccgcagccctcgcgcggcctgcagcgacccggcagcgtccgggaggagggcgcag
ctccgaactggcgacggcgttctggtccctggcagctaa

DBGET integrated database retrieval system