KEGG   Ailuropoda melanoleuca (giant panda): 105237456
Entry
105237456         CDS       T01329                                 

Gene name
TERT
Definition
(RefSeq) telomerase reverse transcriptase
  KO
K11126  telomerase reverse transcriptase [EC:2.7.7.49]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05200  Pathways in cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105237456 (TERT)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105237456 (TERT)
   05226 Gastric cancer
    105237456 (TERT)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105237456 (TERT)
   05165 Human papillomavirus infection
    105237456 (TERT)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.49  RNA-directed DNA polymerase
     105237456 (TERT)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    105237456 (TERT)
   Telomerase complex (fungi)
    105237456 (TERT)
SSDB
Motif
Pfam: Telomerase_RBD RVT_1
Other DBs
NCBI-GeneID: 105237456
NCBI-ProteinID: XP_034513001
Ensembl: ENSAMEG00000010578
LinkDB
Position
3
AA seq 1117 aa
MPRAPRCRAVRSLLRSRYREVLPLATFLRRLGPQGRRLVRRGDPAAFRALVAQCLVCVPW
DARPPPVAPSFRQVSCLKELVARVVQRLCERGARNVLAFGFALLDGARGGPPVAFTTSVR
SYLPNTVTETLRGSGAWGLLLRRVGDDVLTHLLTHCALYVLVARSCAYQVCGPPLYDLCV
PVVRRPLASPGHSPGTRTDLRPTRQAWTSGARRRQGSSGSSPPLAKRPRRGETPEPDPGT
DRPSTRAHLGRAHGPSDCKPRAVTPSRAAAEVSSWEGGPPGTRRISPVAQPSQGPQGVPH
HPAHPETKHFLYSSGGRERLRSSFLLSALPPSLTGARKLVETIFLGSRPGRLGAARRSRR
LPTRYWRMRPLFQELLGNHARCPYRALLRTHCPLRVAATGEASRDRACRGVGVCPSERPT
AAPEESTDPGRLVHLLRQHSSPWQVYAFLRACLCRLVPAGLWGSRHNQHRFLRNVKKFIS
LGKHAKLSLQELTWKMKVQDCAWLHGSPGARCVPAAEHRRREEVLATFLCWLMGTYVVEL
LRSFFYVTETTFQKNRLFFYRKTVWSQLQSIGIRQHFTSVHLRELSAAEVRRHHEARGTL
LTSRLRFLPKPSGLRPIVNMDYVVGARTFRRDKKVQHLTSQVKTLFSVLNYERARRPSLL
GASVLGMDDIHRAWRAFVLRVRARDPAPQLYFVKVDVTGAYDALPQDRLVEVIANVIRPQ
ENTYCMRQYAVVRRTAQGHVRKSFKRHVSTFTDLQPYMRQFVEHLQETSSLRDAVVVEQS
SSLNEAGSGLFHLFLRLVYNHVIRIGGKSYVQCQGIPQGSILSTLLCSLCYGDMEGRLFP
GIQQDGVLLRLVDDFLLVTPHLTQARAFLRTLVRGVPEYGCTANLQKTAVNFPVEDIALG
SAAPLQLPAHCLFPWCGLLLDTRTLEVSCDYSSYAQTSIRSSLTFSQGTRPGRNMRRKLF
AVLRLKCCSLFLDLQVNSVHTVYTNIYKIFLLQAYRFHACVLQFPFNQPVRKNPSFFLRV
IVDTASLCYSLLKAKNTGMSLGTKGASGPFPSEAAQWLCLHAFLLKLARHGGTYRCLLGA
LRAAKAQLCRQLPGVTLAALEAAADPSLTADFKTILD
NT seq 3354 nt   +upstreamnt  +downstreamnt
atgccgcgcgcgccccggtgccgcgcggtgcgctccctgctgcggagccgctaccgcgag
gtgcttcccctggccaccttcctgcggcgcctggggccccagggccggcggctcgtgcgg
cgtggggacccggccgccttccgcgcgctggtggcccagtgcttggtgtgcgtgccctgg
gacgcgcggccgcccccggtcgccccgtccttccgccaggtgtcctgcctgaaggagctg
gtggccagggtggtgcagaggctctgcgagcgcggcgccaggaacgtgctggctttcggc
ttcgccctgctagacggggcccgcggcgggccgcccgtggcctttacgaccagcgtgcgc
agctacctgcccaacacggtaacggagactctgcgtggcagcggcgcgtgggggctgctg
ctgcgccgcgtgggcgacgatgtgctcacgcacctgctcacgcactgcgcgctctacgtg
ctggtggcccggagctgcgcctaccaggtgtgcgggcctcctctctacgacctctgcgtc
cccgtcgtgcgtcggcctctcgcgtcccccggccacagtcctgggacccggacggacctc
agacccacgcgccaggcctggacctccggcgcaaggcggcgtcagggcagctccgggagc
agtccgcctctggccaagagacctagacgcggcgagacgccagagccggacccggggacg
gacaggccgtctacccgggcccacctgggcagggcccatgggccgagtgactgcaagcct
cgcgcagtgacacctagcagggccgctgcagaagtttcctcttgggagggagggccccct
gggactcgtcgcatctccccagtggcacagccttctcaggggccccagggagtaccccat
cacccagcgcaccccgagaccaagcacttcctctacagctcgggaggcagggagcggctg
cgctcctccttcctgctcagtgccctgccgcctagcctgaccggggcccggaaactcgtg
gagaccatctttctgggctccaggcccgggaggctgggggctgcccgcaggtcgcgccgc
ctgcccacgcgctactggcggatgaggcccctgttccaggagctgcttgggaaccacgcg
cggtgcccgtacagggcgctcctcaggacccactgcccgctccgggtggcggccactggg
gaggcgtccagagaccgtgcatgcagaggagtgggcgtgtgcccgtcggagaggcccacg
gcagcccccgaggagagcacggaccccgggcgcctggtccaccttctccggcaacacagc
agtccgtggcaggtgtatgctttcctgcgggcctgcctgtgccggctggtgcccgctgga
ctctggggctccaggcacaaccagcaccgcttcttgaggaacgtgaagaagttcatctct
ctgggaaagcacgccaagctctcgctgcaggagctgacgtggaagatgaaagtgcaggac
tgcgcctggctgcacgggagcccaggggctcgctgcgtcccggccgccgagcaccgtcgc
agggaggaggtcctggccacgttcctgtgctggctgatgggcacgtacgtggttgagctg
ctcaggtcgtttttttacgtcacggaaaccacgtttcagaagaaccggctctttttctac
cggaagaccgtgtggagccagttacagagtataggaatcagacagcacttcaccagcgtg
catctccgagaactgtccgcagcagaggtcagaagacaccacgaagccagaggaactctc
ctaacatcccgactccgcttcctccccaagcccagtgggctgcggcccattgtgaacatg
gactacgtggtgggagccagaacgttccgcagagacaagaaggtccagcatctcacctcg
caagtgaagacgctgttcagcgtgctgaactacgagcgggcccggcgccccagcctcctg
ggggcctccgtgctgggtatggacgacatccacagggcctggcgagcctttgtgctgcgc
gtgcgggcccgggacccggcgccccagctgtactttgtcaaggtggacgtgacgggggcg
tatgatgcccttccccaggacaggctggtagaggtcattgccaacgtgatcaggcctcaa
gaaaacacctactgcatgcgccagtatgccgtggtccggagaaccgcccagggacacgtc
cgcaagtcattcaaaagacacgtgtccaccttcacagacctccagccgtacatgaggcag
ttcgtggagcatctgcaagagaccagctcgctgagggacgctgtggtcgttgagcagagc
tcctctctgaacgaagctggcagcggccttttccacctcttcctgcgtctggtgtataac
cacgtcataaggatcgggggcaagtcgtacgtccagtgtcaggggatcccgcagggctcc
atcctgtccactctgctgtgcagtctctgctacggggacatggagggcaggttgttcccc
ggaatccagcaggacggggtgctgctgcgcctggtggacgacttcctgctggtcacacct
cacctgacgcaagcacgggcctttctcaggaccctggtcagaggtgttcctgagtacggc
tgcacagccaacttgcagaagacggcagtgaacttccccgtggaggacatcgccctgggc
agcgcggcccccctccagctgccagcccactgcctgttcccctggtgcggcttgctgctg
gacacccggaccctggaggtgtcctgtgactactccagctacgcccagacctccatccgc
tcaagcctcaccttcagccagggcaccaggcccggcaggaacatgcgacgcaagctgttc
gccgtcctgcggctcaagtgctgctctttgttcctggatctgcaggtgaacagcgtccac
acggtttataccaacatttacaagatatttctgctgcaggcctacaggttccacgcgtgt
gtgctccagtttccattcaaccagccggtgaggaagaacccctccttcttcctccgcgtc
atcgtggacaccgcgtcactctgctactccctcctgaaagccaagaacacaggcatgtcc
ctggggaccaaaggcgcctctggcccattcccttctgaggccgctcagtggctctgcctc
cacgccttcctgctcaagctggctcgtcacggtggtacctacaggtgtcttctgggggca
ctccgggcagccaaagcgcagctgtgccggcagctcccaggggtgacgctggccgccctg
gaggcagcggctgaccccagcctgaccgcagacttcaagaccattttggactga

DBGET integrated database retrieval system