KEGG   Ailuropoda melanoleuca (giant panda): 105238228
Entry
105238228         CDS       T01329                                 

Gene name
RANBP1
Definition
(RefSeq) ran-specific GTPase-activating protein isoform X1
  KO
K15306  Ran-binding protein 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105238228 (RANBP1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105238228 (RANBP1)
SSDB
Motif
Pfam: Ran_BP1 WH1 DUF1681
Other DBs
NCBI-GeneID: 105238228
NCBI-ProteinID: XP_034499241
LinkDB
Position
14
AA seq 240 aa
MRLFTWRDCPLWALRSSGWGPGSRASRVTSLHLNPQDTHEDHDTSTENADESNHDPQFEP
IVSLPEQEIKTLEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKHKEKGTIRLL
MRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAIRFLNAENAQ
KFKTKFEECRKEIEEREKKAGSGKNDDAEKVTEKLEALSVKAESKESEDAESKAGAEEEQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atgaggctctttacttggagggattgcccactgtgggcactgcggagctctgggtggggg
ccaggctctagggccagcagagtgacctctctgcacctcaatccacaggacacccatgag
gaccatgacacctccactgagaatgcagatgagtccaaccacgacccccagtttgagcct
atagtttctcttcccgagcaagaaattaaaacgctggaagaagatgaagaagagcttttt
aaaatgcgggcaaagctattccgattcgcttcagagaacgatctcccagaatggaaggaa
cgaggcactggtgacgtcaagcttctgaagcataaggagaaagggaccatccgcctcctc
atgaggagggacaagaccctgaagatatgcgccaaccactacatcacaccgatgatggaa
ctgaagccgaatgcaggcagcgaccgtgcctgggtctggaacacccatgctgacttcgcc
gacgagtgccccaagccagagctgctggccatccgcttcctaaatgctgaaaatgcacag
aaattcaaaacaaagtttgaagaatgcaggaaagagatcgaggagagagaaaagaaagca
gggtcgggcaaaaacgacgacgccgagaaggtgaccgagaagctagaagctctctccgtg
aaggcggagagcaaggagtcggaagatgccgagagcaaggctggagccgaggaggagcaa
taa

DBGET integrated database retrieval system