KEGG   Ailuropoda melanoleuca (giant panda): 105238362
Entry
105238362         CDS       T01329                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04630  JAK-STAT signaling pathway
aml04640  Hematopoietic cell lineage
aml05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    105238362 (IL3RA)
   04151 PI3K-Akt signaling pathway
    105238362 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105238362 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105238362 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105238362 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105238362 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:aml04050]
    105238362 (IL3RA)
   04090 CD molecules [BR:aml04090]
    105238362 (IL3RA)
Cytokine receptors [BR:aml04050]
 Interleukin receptor families
  IL3 receptor family
   105238362 (IL3RA)
CD molecules [BR:aml04090]
 Proteins
  105238362 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind LptD
Other DBs
NCBI-GeneID: 105238362
NCBI-ProteinID: XP_011225275
Ensembl: ENSAMEG00000005621
LinkDB
Position
X
AA seq 387 aa
MWPPCRGSRIPMALLWLAVCLTSVSGLLQTEEDPDSPIKNLRMEPGEKRLTWDLHGNVSG
IMCFINSKFITKAINNNRYCQFQVLSSCEVKNFTVSLTKGPPFLMGIQYPLQEGNPGASA
QRLDCWVHDMDFLTCSWEVGREAPSDVQYRLYRQHLWTRREQECPHYEMDDRGKHVRCHF
NDVPRLEKQLQILVRGSSQSARIPCSDRTVELSEIERLNPPNITGTCNKSYSMMKWKVSS
HFNRRYEYELQIQKGSDPAYTEKLQENFFELYNPGNYMARLKVKGFFRNTWSEWSAPQHF
VCDVGEDVPRRDWLLSALGLLATLLVMGLAVVLCRRYSVLQKLFPPIPHMKDPTIDNLQS
SKLVAWEASKASWEDCPVAEVQVLGET
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgtggcctccctgccgtgggagccggatccctatggccttgctgtggctcgcggtgtgt
ctgacgtctgtctcgggtctgctgcaaacggaggaagatcccgattccccgattaagaac
ctaaggatggagccgggagaaaagagattgacctgggacctccatggaaatgtttctgga
attatgtgtttcataaattcaaaatttatcactaaggccatcaacaacaaccgttactgc
cagttccaagtgctttcctcgtgtgaggtgaaaaacttcaccgtctccttgaccaaaggc
ccaccgttcttgatggggattcagtatcctctgcaagaaggaaaccctggggcatccgca
caacgtctggactgctgggtgcacgacatggacttcctgacgtgcagctgggaggtgggc
agggaggcccccagtgacgtccagtatcgcctgtacaggcagcacctgtggacccgcagg
gagcaggagtgtccgcattacgaaatggacgatcgggggaaacacgtccggtgtcatttc
aatgacgtccccagattggagaaacagctccagatcctggtgagaggcagcagccaaagc
gccaggatcccctgctcggaccgtactgtcgaattatcagaaattgagagattaaatcca
cccaatatcactggcacgtgtaataagtcatattcgatgatgaagtggaaagtgtcaagt
cacttcaatcgcagatatgagtatgaacttcaaatacaaaagggcagcgatcccgcctac
acagagaagctccaggaaaacttctttgagctttacaatcccggaaactacatggcgaga
ctaaaggtgaaaggtttcttccgcaacacctggagcgaatggagtgccccccaacacttt
gtgtgcgacgtcggggaggacgtgccgcgccgggactggctgttgtctgcactgggcttg
ctggccacgctgctggtcatggggctggcggtcgtgctgtgcagaaggtactcggttttg
cagaaactcttccctcccatccctcacatgaaagaccccaccattgacaatcttcagagc
agcaagttggtggcctgggaggccagcaaagcaagctgggaggactgcccggtggcggaa
gtgcaggttttgggagaaacatga

DBGET integrated database retrieval system