KEGG   Ailuropoda melanoleuca (giant panda): 105239315
Entry
105239315         CDS       T01329                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04115  p53 signaling pathway
aml04218  Cellular senescence
aml04935  Growth hormone synthesis, secretion and action
aml05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    105239315 (IGFBP3)
   04218 Cellular senescence
    105239315 (IGFBP3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    105239315 (IGFBP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    105239315 (IGFBP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    105239315 (IGFBP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    105239315 (IGFBP3)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    105239315 (IGFBP3)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105239315 (IGFBP3)
SSDB
Motif
Pfam: Thyroglobulin_1
Other DBs
NCBI-GeneID: 105239315
NCBI-ProteinID: XP_034521092
LinkDB
Position
1
AA seq 143 aa
MQGQAFPSTHRGPDAKLQPLHTKMEIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRET
EYGPCRREVEDTLNRLKFLDMLSPRGIHIPNCDRKGFYKKKQCRPSKGRKRGFCWCVDKY
GQPLPGFDARGKGDIHCYSMDSK
NT seq 432 nt   +upstreamnt  +downstreamnt
atgcagggccaggccttccccagcacgcaccgggggcctgacgccaagctccagcccctg
cacaccaagatggagatcatcaagaaagggcacgccaaggacagccagcgctacaaggtg
gactacgagtcccagagcacggacacccagaacttctcctccgagtccaagcgggagacg
gaatacgggccgtgtcgccgggaggtggaggacaccctgaaccgactcaagttcttggac
atgcttagccctaggggcatccacatccccaactgtgacaggaagggcttttacaagaag
aagcagtgccgcccctccaagggcaggaaacggggcttctgctggtgcgtggacaagtac
gggcagccgctgcccggcttcgacgccagggggaaaggtgacattcactgctacagcatg
gacagcaagtag

DBGET integrated database retrieval system