KEGG   Ailuropoda melanoleuca (giant panda): 105242032Help
Entry
105242032         CDS       T01329                                 

Definition
(RefSeq) odorant-binding protein-like
Organism
aml  Ailuropoda melanoleuca (giant panda)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 105242032
NCBI-ProteinID: XP_019665456
LinkDB All DBs
Position
Un
AA seq 173 aa AA seqDB search
MKILLLCLVLALVCDAQPPLLHQLTQLPGKWETLYLAASNPDKTGENSPFRNYMRCIEVD
MVRRKISFHFYIKANGQCTEKTAVGAIGTSNVITVDYEGANVFQVVDMTPNSMLGYDVNV
DEEGNTTDIVFLFGRGSQADEKAVEKFKQFTRQRNIPEENIVKVVGTDDCPVD
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctactattgtgtcttgtactcgctctggtttgtgatgcccagccaccccta
ctgcatcaattaacacagcttccaggaaaatgggagaccctgtatttggcagccagcaac
cctgacaagaccggcgagaacagcccattcaggaattacatgagatgtattgaggtggac
atggtgagaaggaaaatctccttccatttttacatcaaggctaatggacaatgcacagaa
aaaactgctgtgggagcaataggaacaagtaatgttatcactgttgactatgagggggcc
aatgttttccaagttgttgatatgaccccaaatagtatgttaggctatgatgtcaacgtg
gatgaagaaggaaacaccacggacatagttttcttgtttggcagaggatctcaggctgat
gagaaagctgttgaaaaattcaagcagttcactagacaaaggaatattccagaagaaaat
attgtaaaggtcgtcggtactgatgactgtcctgtcgattaa

DBGET integrated database retrieval system