KEGG   Amycolatopsis mediterranei S699: AMES_0831Help
Entry
AMES_0831         CDS       T02190                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00020  Citrate cycle (TCA cycle)
amm00480  Glutathione metabolism
amm01100  Metabolic pathways
amm01110  Biosynthesis of secondary metabolites
amm01120  Microbial metabolism in diverse environments
amm01130  Biosynthesis of antibiotics
amm01200  Carbon metabolism
amm01210  2-Oxocarboxylic acid metabolism
amm01230  Biosynthesis of amino acids
Module
amm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:amm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMES_0831 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMES_0831 (icd)
Enzymes [BR:amm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AMES_0831 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFO74367
UniProt: G0FZM0
LinkDB All DBs
Position
899942..901165
Genome map
AA seq 407 aa AA seqDB search
MAKIKVQGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLDYYDLGIEERDRTDDQVTVDS
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWLSPNGTIRNILGGVIFREPIVIQNIPRL
VPTWTKPIIIGRHAHGDQYKATNFKVPGPGKLTISYTPDDGSEPMEFQVAQFPEGGGVAM
GMYNFKKSIEDFARASLQYGLDRGLPVYLSTKNTILKAYDGQFKDVFEEIFQNEFKADFD
AKGISYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTPDG
RTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLEHRGKLDGNQELIGFANTLE
QVVVETVESGQMTKDLALLISKDQPWQTTEEFLATLDDNLAKKIAQG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtccagggcaccgtcgtcgaactcgacggcgatgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccgtacctggacgtgaacctggac
tactacgacctgggtatcgaggagcgggaccgcaccgacgaccaggtcacggtcgactcc
gcgaacgccatcaagaagcacggcgtcggcgtcaagtgcgccacgatcaccccggacgag
gcccgcgtcgaagagttcggcctcaagaagatgtggctgtccccgaacgggaccatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcgtcatccagaacatcccgcggctg
gtgccgacgtggaccaagccgatcatcatcggccgccacgcccacggcgaccagtacaag
gcgaccaacttcaaggtccccggcccgggcaagctgaccatcagctacaccccggacgac
ggctccgagccgatggagttccaggtcgcgcagttccccgagggcggcggcgtcgccatg
gggatgtacaacttcaagaagtcgatcgaggacttcgcgcgcgcgtcgctgcagtacggc
ctcgaccgcggcctgccggtctacctctccaccaagaacaccatcctcaaggcctacgac
ggccagttcaaggacgtgttcgaggagatcttccagaacgagttcaaggccgacttcgac
gccaagggcatctcctacgaacaccgcctgatcgacgacatggtcgccgcggcgatgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggtgacgtccagtccgacacg
gtcgcgcagggcttcggttcgctcggcctgatgacgtcggtgctgcgcacgccggacggc
cggaccgtcgaggccgaggccgcgcacggcacggtgacccggcactaccgccagcaccag
cagggcaagccgacgtcgaccaacccgatcgcgtcgatctacgcctggacccgcggcctc
gagcaccgcggcaagctggacggcaaccaggagctgatcggcttcgcgaacacgctggag
caggtcgtcgtcgagaccgtcgagagcggtcagatgacgaaggacctcgcgctgctcatc
agcaaggaccagccgtggcagacgaccgaggaattcctcgcgacgctggacgacaacctg
gcgaagaagatcgcccagggctga

DBGET integrated database retrieval system