KEGG   Amycolatopsis mediterranei S699: AMES_4109Help
Entry
AMES_4109         CDS       T02190                                 

Gene name
neu
Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00511  Other glycan degradation
amm00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AMES_4109 (neu)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AMES_4109 (neu)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:amm02042]
    AMES_4109 (neu)
Enzymes [BR:amm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AMES_4109 (neu)
Bacterial toxins [BR:amm02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AMES_4109 (neu)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR BNR_3 DUF4185 Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AFO77645
UniProt: G0FQ82
LinkDB All DBs
Position
complement(4572014..4573507)
Genome map
AA seq 497 aa AA seqDB search
MKITRLAQGLLAGLLGCAALAVPAAIGAATAQADVASTLVFNKDTEGHDCYRIPTIVKAN
NGDLLAFAEGRNGGAHACADLGKIDLVMKRSTDGGKTWGALNTVITAFGDTKGNPAPIVI
PGSDRIVLLSTMQCYTNPDCGRIPRVSISEDNGKTWGAPKTLTTELGFSAAPGWLATGPS
HGIVLTRGAHKGRLVAGMSYSNIGALVYSDDKGSTWHLGATDKPTTSAMNPQEISVTELR
DGRIYAAARNQANDGNKCLEDGTHNRAFAISSDDGATFSSKFDFATDLVAPTVEGSTARM
SATDTGGKYNRILFAAPSVCGEREGLRVHSSFDEGANWTGTAGSLLVWGQGAAYSDMVQL
SQSSVGVLFEVGPTEHPYDAIRFAAVSDAALGAPACGGGYSVIDSAPLGTGGAAGTVYLS
YNAANGQNCVSTMKNASAGTATATAAYLEVKGSARQTDSGSFSYFAGPVKATAADKCVKW
GGAAGGQVYDSQFEHCS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcacccgactcgcccagggcctgctggccggcctgctggggtgcgccgccctg
gcggtcccggcggccatcggcgccgcgaccgcgcaggccgacgtggccagcacattggtg
ttcaacaaggacaccgagggccacgactgctaccgcatccccaccatcgtcaaagcgaac
aacggcgacctgctcgcgttcgccgaaggccgcaacggcggcgcccacgcctgcgccgac
ctgggcaagatcgatctcgtgatgaagcgttccaccgacggtggcaagacgtggggcgcg
ctgaacaccgtcatcacggcgttcggggacacgaagggcaaccccgcaccgatcgtcatc
ccgggcagcgaccggatcgtgctgctgtcgaccatgcagtgctacaccaatcccgactgc
ggccggatcccgcgcgtgtccatcagcgaggacaacgggaagacgtggggcgcgccgaag
acgctgaccacggaactcggcttctcggccgcgccgggctggctggccaccgggccgtcc
cacgggatcgtgctgacgcgcggcgcgcacaagggccggctcgtcgccgggatgagctac
tcgaacatcggcgcgctggtctacagcgacgacaagggcagcacctggcacctcggcgcc
accgacaagccgacgacgagtgcgatgaacccgcaggagatcagcgtcaccgagctccgg
gacggccggatctacgccgccgcgcgcaaccaggcgaacgacggcaacaagtgcctcgag
gacggcacgcacaaccgcgccttcgcgatcagctcggacgacggcgcgacgttcagctcg
aagttcgacttcgccaccgacctcgtcgcgccgacggtcgagggctcgacggcccggatg
agcgccaccgacaccggcggcaagtacaaccggatcctgttcgccgcaccgtccgtttgc
ggcgagcgcgaggggctgcgcgtgcactcgtcgttcgacgagggcgccaactggaccggc
accgccggcagcctgctcgtgtgggggcagggcgcggcgtactcggacatggtgcagctg
tcgcagtcgtcggtcggggtgctgttcgaggtgggtcccacggagcacccctacgacgcg
atccgcttcgcggcggtcagtgacgccgcgctcggcgccccggcctgcggtggcggctac
agcgtgatcgactcggcgcccctgggcaccggcggcgcggccggcacggtgtacctgtcg
tacaacgcggccaacggccagaactgcgtcagcaccatgaagaacgcctccgccgggacg
gccaccgcgaccgcggcctacctggaggtcaagggctcggcgcggcagaccgactcgggc
tcgttctcctacttcgccggcccggtcaaggccacggcggcggacaagtgcgtgaagtgg
ggcggcgcggccggcggccaggtctacgacagccagttcgagcactgcagctga

DBGET integrated database retrieval system