KEGG   Amycolatopsis mediterranei S699: AMES_5142Help
Entry
AMES_5142         CDS       T02190                                 

Gene name
lig
Definition
(GenBank) ATP-dependent DNA ligase
Organism
amm  Amycolatopsis mediterranei S699
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AFO78678
UniProt: G0FQR1
LinkDB All DBs
Position
complement(5785673..5786617)
Genome map
AA seq 314 aa AA seqDB search
MTGPGWREPTLATLTDRRFSDEDWIFERKLDGVRAICVRDSGTPTLYSRNHKVMDNAYPE
IVEALAAQGGPRFVADGEIVAFDGANTSFAALQPRIHVSDPDRARATGVRVYYYLFDLLY
LDDRDTTALPLRQRKALLREAFGFADPLRLSAHRNTEGEKFFEEACRRGWEGVIAKRADA
PYHHGRSPDWLKFKCAQGQEFVIGGFTDPQGARHGFGALLLGYHDDDGLRYAGKVGTGFD
ERLLTSLHARLRDRETARSPFAGPVKEPGAHWVRPELVAQIGFSEWTRDGRLRHPRFAGL
REDKKAADVVRERA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggtcccggctggcgcgagccgaccctggccacgctcaccgaccgccggttctcc
gacgaggactggatcttcgagcgcaagctggacggcgtccgcgcgatctgcgtccgcgac
tccggaacgcccacgttgtactcgcgcaaccacaaggtgatggacaacgcctacccggag
atcgtcgaggccctcgccgcccagggcggcccgcggttcgtcgccgacggcgagatcgtc
gcgttcgacggtgccaacaccagcttcgccgcgctccagccccggatccacgtcagcgac
ccggatcgggcccgcgcgaccggcgtgcgcgtctactactacctgttcgacctgctgtac
ctcgacgaccgggacacgaccgcgctgccgctgcggcagcggaaggcgttgctgcgggag
gcgttcggcttcgcggacccgctccggctgtcggcgcaccgcaacaccgagggggagaag
ttcttcgaggaagcgtgccggcgcggctgggagggcgtcatcgccaagcgggcggacgcg
ccgtaccaccacgggcggtcacccgactggctgaagttcaagtgcgcgcagggccaggag
ttcgtcatcggcggcttcaccgacccgcagggtgcccgccacggcttcggcgcgctcctg
ctgggctaccacgatgacgacggcctccggtacgcgggcaaggtcggtaccggcttcgac
gagcggctgctgacgtcgttgcacgcgcggctgcgggaccgggagacggcgcggtcgccg
ttcgccgggccggtcaaggaaccgggggcgcactgggttcggccggagctggtggcgcag
atcggcttctccgagtggacgcgcgacgggcggctgcggcacccgcggttcgccgggctg
cgcgaggacaagaaggccgcggacgtcgtacgggagcgcgcgtga

DBGET integrated database retrieval system