KEGG   Amycolatopsis mediterranei S699: AMES_8438Help
Entry
AMES_8438         CDS       T02190                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
amm00500  Starch and sucrose metabolism
amm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMES_8438
Enzymes [BR:amm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AMES_8438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AFO81970
UniProt: G0G4A4
LinkDB All DBs
Position
complement(9416377..9418542)
Genome map
AA seq 721 aa AA seqDB search
MRKLIFGALAGLLVTGLIPATAAAQGEAPGAPGTHPSWLPANKTGFGTAHDRSSNVWFTL
QGGQLSEVYYPDMSTPSVRSMDFVVTDGRSFAVTDYSAKSQQVRRTGDDSLTYEQTVTDD
QHRWRLRKTYVTDPAATTVLVDVDFQSLTGRPYQLYAVADPDLTNDGSDDSAARSGDALT
AQDATNAAALTAQPAFTTTSVGYAGASDGNTQLTKTFKLDRYDTAAKGNVVLTGRTNADG
VRDRHVTVALGMGAKAADALKSAQASQRRGFRDIARAYDRGWQQYLRGVAKPPSSLKTGA
ERDLYKASMLTLAASEDKHHPGAFIASPSMPWRFGNNDPEWSPSGTYHLVWPRDLYQIAT
GLAAGGDTAAANRAVSYMFGTQQQPDGHLPQNSRVDGVPYWTSIQLDETAFPIVLAQQLG
RNDLWPGVRKAADFILGYKGPNGQASPYTQQERWEEQDGWSPSTIASVIAGLVCAADIAS
HNGAAADAARYLAAADKMKADLPKQTITTNGPLSKDPYFVRLTKDANANAGTTYNLGNSS
VTMDQRAVTDAGFLDLVRLGVYRADDPVIRNSVRVTDKEIAFTTPTGQFWHRYTKDGYGE
QADGSPWDYTFPAESRTTFGRLWPLLAGERGEYELTLGDRASAARRLRDLGRVSSSAETM
PEQVWDENPPSGQTGFPAGTPTTSATPLAWTHAQYVRLAWDVKAGSVLETPRVVRCHFLG
C
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaactcatcttcggcgccctcgccgggctgctggtcaccggcctgatcccggcg
accgcggcggcgcagggggaggctcccggtgcccccgggacccatcccagctggctaccc
gcgaacaagaccggcttcgggaccgcgcacgaccggtccagcaacgtctggttcaccctc
cagggcgggcagctgtccgaggtctactacccggacatgtccacgcccagcgtccgctcg
atggacttcgtcgtcacggacggccgcagcttcgccgtcaccgactactcggcgaagtcg
cagcaggtccggcggaccggcgacgacagcttgacgtacgagcagaccgtcaccgacgac
cagcaccggtggcgcctccgcaagacctacgtcaccgacccggccgccacgaccgtgctg
gtggacgtcgacttccagtcgctcaccgggcggccctaccagctctacgcggtcgccgac
ccggacctcaccaacgacggctccgacgactcggccgctcgctcgggtgacgccctcacg
gcgcaggacgccacgaacgccgctgcgctgaccgcgcagcccgcgttcaccacgaccagt
gtcggctacgcgggcgcctccgacgggaacacccagctcaccaagaccttcaagctcgac
cggtacgacaccgcggccaagggcaacgtcgtgctgaccggccggacgaacgccgacggc
gtccgcgaccggcacgtcaccgtggccctcggcatgggcgcgaaggccgccgacgcgctc
aagagcgcgcaggcgtcgcagcgacgcggcttccgcgacatcgcgcgcgcctacgaccgc
ggctggcagcagtacctgcgcggggtcgccaagccgccgtcgtcgctgaagaccggcgcc
gagcgcgacctgtacaaggcgtcgatgctgacgctcgccgcgagcgaggacaagcaccac
cccggcgccttcatcgcgtcgccgagcatgccgtggcggttcgggaacaacgaccccgag
tggtcgccgtcgggcacctaccacctggtctggccgcgtgacctctaccagatcgcgacc
gggctggccgccggcggcgacacggccgccgcgaaccgcgcggtgtcgtacatgttcggc
acgcagcagcagcccgacgggcacctgccgcagaacagccgggtcgacggcgtgccgtac
tggacgtcgatccagctcgacgagaccgcgttcccgatcgtgctcgcccagcagctgggc
cggaacgacctgtggcccggcgtccgcaaggccgccgacttcatcctcggctacaagggg
ccgaacgggcaggcgtcgccgtacacccagcaggagcgctgggaggagcaggacggctgg
tccccgtcgacgatcgcctcggtgatcgccgggctcgtctgcgccgcggacatcgcttcg
cacaacggcgcggccgccgacgccgcccgctacctcgccgcggccgacaagatgaaggcc
gacctgccgaagcagacgatcaccacgaacgggccgctgtcgaaggacccgtacttcgtc
cggctcacgaaagacgcgaacgcgaacgccgggacgacgtacaacctcggcaactcgagc
gtgacgatggaccagcgtgcggtcaccgacgcgggcttcctcgacctggtccggctcggc
gtctaccgcgccgacgacccggtgattcgcaacagcgtgcgcgtgaccgacaaggaaatc
gcgttcactacgccgaccggtcagttctggcaccggtacacgaaggacggctacggcgag
caggccgacggctcgccgtgggactacacgttcccggcggagagccgcacgacgttcggc
cggttgtggccgctgctcgccggcgagcgcggcgagtacgagctgacgctcggtgaccgc
gcctcggccgcgcggcggctgcgtgacctcggccgggtgagcagctcggcggagaccatg
ccggagcaggtgtgggacgagaacccgccgtccgggcagaccggcttcccggccggcacg
cccacgacgtcggcgaccccgctggcctggacgcacgcccagtacgtccggctcgcctgg
gacgtcaaggcgggctcggtgctggagacgcctcgagtggtccgctgtcacttcctcggc
tgctga

DBGET integrated database retrieval system