KEGG   Amycolatopsis mediterranei S699: RAM_04255Help
Entry
RAM_04255         CDS       T01822                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00020  Citrate cycle (TCA cycle)
amn00480  Glutathione metabolism
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01120  Microbial metabolism in diverse environments
amn01130  Biosynthesis of antibiotics
amn01200  Carbon metabolism
amn01210  2-Oxocarboxylic acid metabolism
amn01230  Biosynthesis of amino acids
Module
amn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RAM_04255
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RAM_04255
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RAM_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEK39343
UniProt: G0FZM0
LinkDB All DBs
Position
891514..892737
Genome map
AA seq 407 aa AA seqDB search
MAKIKVQGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLDYYDLGIEERDRTDDQVTVDS
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWLSPNGTIRNILGGVIFREPIVIQNIPRL
VPTWTKPIIIGRHAHGDQYKATNFKVPGPGKLTISYTPDDGSEPMEFQVAQFPEGGGVAM
GMYNFKKSIEDFARASLQYGLDRGLPVYLSTKNTILKAYDGQFKDVFEEIFQNEFKADFD
AKGISYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTPDG
RTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLEHRGKLDGNQELIGFANTLE
QVVVETVESGQMTKDLALLISKDQPWQTTEEFLATLDDNLAKKIAQG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtccagggcaccgtcgtcgaactcgacggcgatgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccgtacctggacgtgaacctggac
tactacgacctgggtatcgaggagcgggaccgcaccgacgaccaggtcacggtcgactcc
gcgaacgccatcaagaagcacggcgtcggcgtcaagtgcgccacgatcaccccggacgag
gcccgcgtcgaagagttcggcctcaagaagatgtggctgtccccgaacgggaccatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcgtcatccagaacatcccgcggctg
gtgccgacgtggaccaagccgatcatcatcggccgccacgcccacggcgaccagtacaag
gcgaccaacttcaaggtccccggcccgggcaagctgaccatcagctacaccccggacgac
ggctccgagccgatggagttccaggtcgcgcagttccccgagggcggcggcgtcgccatg
gggatgtacaacttcaagaagtcgatcgaggacttcgcgcgcgcgtcgctgcagtacggc
ctcgaccgcggcctgccggtctacctctccaccaagaacaccatcctcaaggcctacgac
ggccagttcaaggacgtgttcgaggagatcttccagaacgagttcaaggccgacttcgac
gccaagggcatctcctacgaacaccgcctgatcgacgacatggtcgccgcggcgatgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggtgacgtccagtccgacacg
gtcgcgcagggcttcggttcgctcggcctgatgacgtcggtgctgcgcacgccggacggc
cggaccgtcgaggccgaggccgcgcacggcacggtgacccggcactaccgccagcaccag
cagggcaagccgacgtcgaccaacccgatcgcgtcgatctacgcctggacccgcggcctc
gagcaccgcggcaagctggacggcaaccaggagctgatcggcttcgcgaacacgctggag
caggtcgtcgtcgagaccgtcgagagcggtcagatgacgaaggacctcgcgctgctcatc
agcaaggaccagccgtggcagacgaccgaggaattcctcgcgacgctggacgacaacctg
gcgaagaagatcgcccagggctga

DBGET integrated database retrieval system