KEGG   Amycolatopsis mediterranei S699: RAM_04650Help
Entry
RAM_04650         CDS       T01822                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
amn  Amycolatopsis mediterranei S699
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo KfrA_N Pkinase_fungal Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AEK39422
UniProt: G0G1K2
LinkDB All DBs
Position
complement(970131..971873)
Genome map
AA seq 580 aa AA seqDB search
MVAGRYRLRSVLGSGSMGTVWSAYDEFLHRQVAVKEMKVPPGIPAAQADELRERTLREAR
AIAVLSHPNVIILHDVAREDDQPFVVMELLPSRSLAHILRDHGPLTVGQAAAVGIAVASA
LEAAHAAGITHRDVKPGNVLVASDGRIKLTDFGIARNVSEATMTRTGIMLGSPAYIAPEV
ASGGAVTPAADLWGLGATLFAAVEGAPPYDADGDPLETVGKVVNGKVPKPKAGPLADVIS
ALMTKEPGRRITLRDVRHRLYPLQTKTPLDLFGPELFHTPDGKKTSAQPDATDTQVIKTV
LPEKAKAEKKAEASSSELAADPGPLPFLRPPAPAPSAGPTSGAPTMFVAPPPPRPARRSS
TATAVLVAVAILLFLLAAGGGFALARTVGGQSLLPPAAAPRSPSNGPTDVPPPTLVQQSG
DASFATGNGGQFGLQVPEGWQKFVAPHTTTKFGASTAVQYVSPDGRRSLRVERLVKYFTQ
FPDDVEYINWLKTSYQGNGFQLFNPSPLADKKGTTLTYRVTEGGNLPDRDGAGGTRVTFM
NLIQAGTSLWILSVTVPAEQENSGREDVFNRVAPTLSVSD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgccggtcgctaccggctgcgttcggtgctcggctccgggtcgatgggcaccgtg
tggtcggcctacgacgagttcctgcaccggcaggtggccgtcaaggagatgaaggtgccg
ccgggcatcccggcggcgcaagcggacgagctgcgggagcgcacgctgcgtgaagcccgc
gccatcgccgtcctctcccacccgaacgtgatcatcctgcacgacgtcgcccgcgaggac
gaccagccgttcgtggtgatggagctgctgccgtcgcgcagcctggcgcacatcctgcgc
gaccacgggccgctgaccgtcgggcaggccgccgcggtcggcatcgccgtcgcgtccgcg
ctggaggccgcgcacgccgccgggatcacccaccgtgacgtcaagccgggcaacgtcctg
gtggccagcgacggccggatcaagctgaccgacttcggcatcgcccgcaacgtctccgag
gcgaccatgacccgcaccgggatcatgctcggctcgcccgcctacatcgcgccggaagtg
gcctccggcggcgccgtcacgccggccgcggacctctggggcctcggcgcgacgctgttc
gccgcggtcgaaggcgcgccgccgtacgacgccgacggcgacccgctggagacggtcggc
aaggtcgtcaacgggaaggtgccgaagccgaaggccggcccgctcgccgacgtcatcagc
gccctcatgacgaaggagccggggcggcggatcacgctgcgggacgtccggcaccggctg
tacccgctgcagacgaagacgccgctcgacctgttcgggcccgagctgttccacaccccg
gacggcaagaagacctccgcgcagccggacgcgaccgacacgcaggtgatcaagaccgtc
ctgcccgagaaggccaaggcggagaagaaggccgaggcgtcgagcagcgagctcgccgcc
gaccccggcccgctgccgttcctgcgcccgcccgcccccgcgccgtcggcgggccccacc
tcgggtgcgccgacgatgttcgtcgcaccgcctccgccgcggccggcgcggcgcagctcc
acggccaccgcggtgctcgtcgcggtggcgatcctgctcttcctgctcgccgcgggtggc
gggttcgcgctggccaggacggtcggcggccagtcgctgctgcctccggccgccgcgccg
cggagcccgtcgaacggcccgaccgacgtgccgccgccgacgctggtccagcagtccggc
gacgcgagcttcgcgaccggcaacggcgggcagttcggcctccaggtgccggagggctgg
cagaagttcgtcgccccgcacacgacgacgaagttcggggcgagcacggcggtccagtac
gtctcccccgacggccgccggtcgctgcgggtcgagcggctggtgaagtacttcacccag
ttccccgacgacgtcgaatacatcaactggctgaagacgtcctaccagggcaacgggttc
cagctcttcaacccgtcgccgttggcggacaaaaagggcacgacgctgacgtaccgcgtg
accgagggcggcaacctccccgaccgcgacggggccggcggcacccgggtgacgttcatg
aacctgatccaggcgggcacgagcctgtggatcctctcggtcaccgtgccggccgaacag
gagaactcgggccgcgaggacgtcttcaaccgcgtcgcccccaccctcagcgtctcggac
taa

DBGET integrated database retrieval system