KEGG   Amycolatopsis mediterranei S699: RAM_06070Help
Entry
RAM_06070         CDS       T01822                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00250  Alanine, aspartate and glutamate metabolism
amn00280  Valine, leucine and isoleucine degradation
amn00410  beta-Alanine metabolism
amn00640  Propanoate metabolism
amn00650  Butanoate metabolism
amn01100  Metabolic pathways
amn01120  Microbial metabolism in diverse environments
Module
amn_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RAM_06070
   00650 Butanoate metabolism
    RAM_06070
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RAM_06070
   00280 Valine, leucine and isoleucine degradation
    RAM_06070
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RAM_06070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amn01007]
    RAM_06070
Enzymes [BR:amn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RAM_06070
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     RAM_06070
Amino acid related enzymes [BR:amn01007]
 Aminotransferase (transaminase)
  Class III
   RAM_06070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEK39706
UniProt: G0G624
LinkDB All DBs
Position
complement(1263035..1264390)
Genome map
AA seq 451 aa AA seqDB search
MTASTTAGPQAPAPRQRRLQTEIPGPLSRELQQRRAAAVAAGVSSVLPVYVTSASGGLLT
DADGNVLIDFGSGIAVTNVGHSAPAVVDRVRKQACWFTHTCFMVTPYEGYVEVCEALAEL
TPGDHAKKSVLFNSGAEAVENAVKIARVATGRQAVVVFDHAYHGRTNLTMGMTAKSVPYK
HGFGPFAPELYRVPGSYPFRDGLSGPEAAALAIDRIEKQIGGDQVAAVVLEPIQGEGGFI
EPARGFLPAIAAWCRENGVVYVADEVQTGFCRTGSWFASTDEDVVPDLIATAKGIAGGLP
LSAVTGRAALLDAVGPGGLGGTYGGNPIACAAALGSIETMKTEHLAASAKRIEGVVLPRL
RALASETGVIGDVRGRGAMLAAEFVKPGSAEPDADLTKRVAAACHRAGVVVLTCGTYGNV
VRLLPPLSLADDLLDEGLSVLEHAVRTEVRA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcaagcaccaccgccgggccgcaggcgccggcgccccgccagcgcaggctgcag
accgaaatccccggccccctctcgcgtgagctgcagcagcgccgcgccgccgccgtcgcc
gccggggtcagctcggtgctgcccgtctacgtcacctccgccagcggcgggctgctcacc
gacgccgacggcaacgtgctgatcgacttcggctccggcatcgcggtgaccaacgtcggg
cactccgcgccggcggtggtcgaccgcgtccgcaagcaggcctgctggttcacccacacc
tgtttcatggtcacgccgtacgaggggtacgtcgaagtctgcgaagcgctggccgagctg
acccccggcgaccacgcgaagaagtcggtgctgttcaactcgggcgccgaggccgtcgag
aacgctgtcaagatcgcgcgggtcgcgaccggacgccaggccgtcgtcgtgttcgaccac
gcctaccacggccgcaccaacctcacgatgggcatgaccgcgaaatccgtgccctacaag
cacgggttcggcccgttcgcgcccgagctctaccgggtgccgggctcgtacccgttccgc
gacggcctgtccggccccgaagcggcggcgctggccatcgaccggatcgagaagcagatc
ggcggcgaccaggtggccgcggtggtcctggagccgatccagggcgagggcggcttcatc
gagcccgcgcgcggcttcctgcccgcgatcgcggcgtggtgccgcgaaaacggcgtcgtg
tacgtcgccgacgaggtccagaccggcttctgccgcaccggttcgtggttcgcctccacc
gacgaagacgtggtgccggacctgatcgcgacggccaagggcatcgcgggcggcctgccg
ctgtccgccgtcaccggccgcgctgccttgctggacgccgtcggcccgggtggtctcggc
gggacctacggcggcaacccgatcgcgtgcgccgcggcgctcggctcgatcgagacgatg
aagaccgagcacctcgccgcgtcggccaagcgcatcgaaggcgtcgtgctgccgcggctg
cgggcgctggcctcggaaacgggggtcatcggcgacgtccgcgggcgcggcgcgatgctg
gccgcggagttcgtcaagcccggttcggcggagccggacgccgacctcaccaagcgcgtc
gcggcggcctgtcaccgcgccggggtcgtggtgctgacctgcgggacctacggcaacgtc
gtccggctgctgccgccgctgtcgctggccgacgacctgctcgacgagggcctctcggtg
ctcgaacacgctgtccggacggaggtccgcgcatga

DBGET integrated database retrieval system