KEGG   Amycolatopsis mediterranei S699: RAM_13570Help
Entry
RAM_13570         CDS       T01822                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
amn  Amycolatopsis mediterranei S699
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEK41202
UniProt: G0G9E1
LinkDB All DBs
Position
complement(2854924..2856003)
Genome map
AA seq 359 aa AA seqDB search
MPLPLQPPLKPMLAKPAKAIPESGGLLFEPKWDGFRCIVFRDGDELYLQSRAEKPLNRYF
PEAVARLLDTLPPRVVLDGELVVARDGRLNFDALTERIHPAESRITLLSAEQPAEFVAFD
VLALGDDLLLDEPTSVRRERLTELAGDRFPLTPATTDPATARHWFELFEGAGLDGVIGKP
LDEPYTPGKRVMLKYKHLRTADCVLAGLRWHVDGGPGELVGSFLLGLYDEKGVLHHVGTV
GAFPKDRRRELAEELAPLITDGEDHPWGGRATGEAQRIPGGITRWRATEHEWVPLRPERV
VEVAYENTEGGMPSRFRHNARFKRWRPDREPASCDYSQLEEPARYDLDAVFRGQVVRTR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccctaccgctgcagccgccgctgaagccgatgctcgccaagcccgccaaggccatc
cccgaatccggtggcctgctgttcgaaccgaagtgggacggcttccgctgcatcgtcttc
cgcgacggcgacgagctgtacctgcagtcgcgcgcggaaaagccgctcaaccggtacttc
ccggaggccgtcgcgcggctgctggacaccctgccgccgcgggtcgtgctcgacggcgag
ctcgtcgtcgcgcgcgacggacggctgaacttcgacgccctcaccgagcgcatccacccc
gccgaaagccggatcacgctgctgtccgccgagcagcccgccgagttcgtcgccttcgac
gtcctggccctgggggacgacctgctgctcgacgaaccgacgtccgtccgccgcgaacgc
ctcaccgaactggccggcgaccggttcccgctcaccccggcgaccaccgatcccgccacc
gcgcgccactggttcgagctgttcgaaggcgccggcctcgacggcgtcatcggcaagccg
ctcgacgagccctacacccccggcaagcgcgtgatgctcaagtacaagcacctgcgcacc
gccgactgcgtgctcgccggcctgcgctggcacgtcgacggcggcccgggcgaactcgtc
ggctccttcctgctcggcctgtacgacgaaaagggcgtgctgcaccacgtcggcaccgtc
ggggcgttccccaaggaccgccgccgcgaactcgccgaagagctggcgccgctgatcacc
gacggcgaggaccacccgtggggcggccgggccaccggtgaggcccagcgcatccccggc
ggcatcacccgctggcgcgccaccgagcacgaatgggtaccgctgcggcccgagcgcgtc
gtcgaggtcgcctacgagaacaccgaaggcggcatgccgtcgcggttccggcacaacgcg
cggttcaagcgctggcggcccgaccgcgaacccgcgtcgtgcgactacagccagctcgag
gagccggcccgctacgacctcgacgccgtcttccgcggccaggtggtgcggacccgctaa

DBGET integrated database retrieval system