KEGG   Amycolatopsis mediterranei S699: RAM_22485Help
Entry
RAM_22485         CDS       T01822                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00564  Glycerophospholipid metabolism
amn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RAM_22485
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RAM_22485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA Pyr_redox NAD_binding_8 3HCDH_N GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: AEK42977
UniProt: G0FXU0
LinkDB All DBs
Position
4839630..4841318
Genome map
AA seq 562 aa AA seqDB search
MTALSPQYRAETLRKLVDEEVDVLVVGGGVTGAGVALDAASRGLSTALVEARDFAAGTSS
RSSKLIHGGLRYLEQLDFKLVREALKERGLLLQTLAPHLVRPVKFLVPLQHRVWERGYIG
AGVTLYDTLGGARALPRHRHLSKRGAFKVAPALADDALIGAIQYYDAQVDDARHTMTIAR
TAAEQGASVLTRARVTSLLRDGERVVGAKVVDRESGIEFEIRARTVVAATGVWSDDMAEA
AGIPTPFTVRASKGIHLVVPREKIDLDTGLILRTEKSVLFVIPWGKHWLVGTTDTEWDLD
REHPAASRADVDYVLEHLNAVLRTPVTHDDIEGVYAGLRPLLAAKAAATTKLSREHAVAH
PVPGLVIVAGGKYTTYRVMAADAVDVAVEELGRPAPPSWTDRLPIAGAEGYHELWEDRFG
VAAKSGLPLTRVEHLLQRYGTRIWNLLELIEEQPSLGEPITETSEYLRVEAVYAVSHEGA
LHLEDVLTRRTRISIEERDRGVAAAPVVAGLMAPLLGWDAHRTDREVANYLARVEAERSA
QEAPDDAAANATRLTAPALLPS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgctttccccgcagtaccgcgcggaaacgttgcggaagctggtggacgaagag
gtcgacgtgctcgtcgtcggcgggggagtgaccggggccggcgtcgcgctcgacgccgcg
tcccgggggctgtcgaccgcgctggtcgaggcccgcgacttcgccgccggcacgtccagc
cggtcgtccaagctgatccacggcgggctgcgctacctggaacagctggacttcaagctg
gtccgcgaggcgctcaaggagcggggcctgctgctgcagacgctggccccgcacctggtg
cggccggtgaagttcctggtcccgctgcagcaccgggtgtgggagcgcggctacatcggc
gccggcgtcacgctgtacgacaccctcgggggcgcccgcgcgctgccgcggcaccggcac
ctgtccaagcggggcgccttcaaggtcgcgccggcgctcgcggacgacgcgctgatcggg
gcgatccagtactacgacgcccaggtcgacgacgcccgccacacgatgacgatcgcgcgg
acggccgccgagcagggcgcttcggtcctgacccgggctcgcgtgacttcgctgcttcgc
gacggcgagcgggtcgtcggcgcgaaggtggtcgaccgcgagagcggcatcgagttcgag
atccgggcgcgcaccgtggtggccgcgaccggcgtgtggagcgacgacatggcggaggcg
gccgggatccccacgccgttcaccgtgcgcgcgtcgaagggcatccacctcgtggtgccg
cgggagaagatcgacctggacaccgggctgatcctgcgcaccgagaagagcgtgctgttc
gtgatcccgtggggcaagcactggctcgtcggcaccaccgacaccgagtgggacctcgac
cgcgagcacccggcggcgagccgcgcggacgtcgactacgtgctcgaacacctcaacgcc
gtcctgcgtacccccgtgacgcacgacgacatcgagggcgtgtacgccggtctccgcccc
ctgctggcggcgaaggcggccgcgacgacgaagctgtcgcgggagcacgcggtggcgcac
ccggtgccgggcctggtcatcgtggccggcggcaagtacacgacgtaccgggtgatggcc
gcggacgcggtcgacgtcgcggtcgaggagctcggccgcccggccccgccgtcgtggacc
gaccggctcccgatcgccggtgccgagggctaccacgagctgtgggaggaccggttcggc
gtggccgcgaagtcgggactgccgctgacccgcgtcgagcacctgctgcagcggtacggc
acgcggatctggaacctcctcgagctgatcgaggagcagccttcgctcggggaaccgatc
acggagacctcggagtacctgcgcgtggaggccgtctacgcggtctcccacgagggtgcg
ctgcacctggaggacgtcctgacccggcggacgcggatctcgatcgaggaacgcgaccgg
ggcgtggcggcggcgcccgtcgtggccggcctcatggccccgctgctgggctgggacgcg
caccgcacggaccgcgaggtggcgaactacctggcccgggtggaggcggagcgctcggcc
caggaagccccggacgacgcggcggcgaacgccacccgcctcacggccccggcgctgctg
ccgagctga

DBGET integrated database retrieval system