KEGG   Amycolatopsis mediterranei S699: RAM_30010Help
Entry
RAM_30010         CDS       T01822                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
amn  Amycolatopsis mediterranei S699
Brite
KEGG Orthology (KO) [BR:amn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amn01001]
    RAM_30010
Enzymes [BR:amn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RAM_30010
Protein kinases [BR:amn01001]
 Serine/threonine kinases: Other
  Bacterial family
   RAM_30010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR Pkinase PknG_rubred Pkinase_Tyr TPR_19 DZR zf-NADH-PPase
Motif
Other DBs
NCBI-ProteinID: AEK44477
UniProt: G0FTN5
LinkDB All DBs
Position
complement(6488654..6490867)
Genome map
AA seq 737 aa AA seqDB search
MTTETAWCHGQPVGPIGFCEVCGRRRVPAEPPAASGPAPESTRRSVELGRSVELWSGEAD
FQSLPAIEVPDPEKLVLADPDYPEQHRFCGHCGAPVGRAFAGEPAFAEGFCEDCGERFSF
LPKLKRGELVGDRYDVLGCFARGGLGWVYLAADTALAGQHVALKGVINSGNAVLRAMARV
ERDVLVRLDHPNIVRISDFVEHPPPGGGEPDTYLVMEYVGGRSLRDLLKQGPPPRVEHVI
VYGRAILGALDYLHGEGLLYCDMKPENVIHGDKRVKVIDLGAARSIADPAGPSVGTEGFQ
APAHELARYGLTVRSDLHTVGRTLQVLLEAASEDADPARVAGGLDSLNRVLERAVAPFER
RFATASEMAEQLDGVRREILSLRDERPRPVPSALFEDTAELLDDGLGAVPGLDHWVGGER
VAVGLDLGLPRAADGAGRLPIPRVAPDDPATEFIAAAGAPGPHRWLDKLTMFGEPSVEIA
FARTRAQVALGNSDAAAAALAFAEEKLGTEAARDWRAAWHHGLLALARDDAEQAAAAFDR
VHRSWPGEIAPKLALGFCAELRGDTEQAERHYRSVWHRDHSQVSAAFGLARCHLRTRGRD
AAVTLLDAVPPISRHYDAARIAAVRIRAGRLPSGPPGRDDFADAARRLPELYLDREAQDR
LEALVREAALAGLPTLAGLRGLEDWNGGALLGERVTERGLRSLVEVSLRRLAERAPDRNS
HGVLVDLANSVRPKTRR
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacggaaacggcgtggtgccacggacaaccggtcgggccgatcgggttctgtgag
gtgtgcggccgccgccgggtgccggccgagccgccggccgcgtccggaccggccccggag
agcacccggcgcagtgttgaactcggacgcagtgttgaactctggagcggcgaggcggac
ttccagtcgctgcccgcgatcgaggtgccggaccccgagaagctcgtcctggccgacccg
gactaccccgagcagcaccggttctgcggccactgcggggcacccgtcggccgcgccttc
gccggcgaaccggcgttcgccgaggggttctgcgaagactgcggcgagcgcttctccttc
ctgcccaagctgaaacgcggcgagctggtcggcgaccgctacgacgtcctcggctgcttc
gcccggggcgggctcggctgggtgtacctggccgccgacacggcgctggccggccagcac
gtcgcgctcaagggcgtgatcaacagcggcaacgccgtgctgcgtgcgatggcgcgggtc
gagcgcgacgtgctcgtccggctcgaccacccgaacatcgtgcgcatcagcgacttcgtc
gagcacccgccgcccggcggcggcgaaccggacacctacctggtgatggagtacgtcggc
gggcggtcgctgcgggacctgctgaagcaagggccgccgccgcgcgtggagcacgtgatc
gtctacggccgggcgatcctcggtgcgctggactacctgcacggcgagggcctgctctac
tgcgacatgaagccggaaaacgtgatccacggcgacaagcgggtcaaggtcatcgacctc
ggcgcggcccgctcgatcgcggacccggccgggccgagcgtcggcaccgaagggttccag
gcaccggcgcacgagctcgcccggtacggcctgaccgtgcgctcggacctgcacaccgtg
ggccggacgctgcaggtgctgctcgaagccgcgagcgaagacgccgacccggcccgcgtc
gccggtggcctcgactcgctgaaccgggtgctcgaacgcgccgtcgcgccgttcgagcgg
cggttcgccaccgcgtccgaaatggccgagcagctcgacggggtgcgccgggaaatcctt
tcgctgcgcgacgaacggccgcggccggtgccctcggcgctgttcgaggacaccgcggaa
ctgctcgacgacggcctcggcgcggtgcccggcctcgaccactgggtcggcggcgaacgc
gtcgccgtcgggttggacctcggcctgccgcgtgccgccgacggcgccggccggctgccg
atcccgcgcgtcgctcccgacgacccggcgaccgagttcatcgccgccgcgggggcgccg
gggccgcaccgctggctggacaagctgacgatgttcggcgagccctcggtcgagatcgcg
ttcgcccggacgcgggcccaggtcgcgctcgggaactccgatgccgcggccgcggcactg
gcgttcgccgaagaaaagctcgggaccgaggccgcgcgggactggcgggccgcgtggcac
cacgggctgctggcgctggcccgcgacgacgccgagcaggcggcggccgcgttcgaccgg
gtgcaccgcagctggcccggcgagatcgcgccgaagctggcgctcgggttctgcgccgaa
ctgcgcggggacaccgagcaggccgaacgccactaccgctcggtgtggcaccgcgaccac
agccaggtcagcgccgccttcggcctggcccgctgccacttgcggacccgcggccgcgac
gccgcggtcaccctgctcgacgccgtgccaccgatctcgcgccactacgacgccgcgcgg
atcgccgcggtgcggatccgggccgggcgcctgccgtccggcccgcccggccgcgacgac
ttcgccgacgcggcgcggcggctgcccgagctctacctcgaccgggaggcccaggaccgg
ctggaggcgctagtccgcgaggccgcgctcgccggcctgcccacgctggccgggctccgc
ggcctcgaagactggaacggcggcgcgctcctcggcgagcgcgtcaccgaacgcggcctg
cggtcgctggtggaagtgtccctgcgccggctcgccgagcgggcgccggaccggaactcc
cacggcgtgctggtcgatctcgcgaactccgtccggccgaagacgagaaggtga

DBGET integrated database retrieval system