KEGG   Amycolatopsis mediterranei S699: RAM_30985Help
Entry
RAM_30985         CDS       T01822                                 

Gene name
argJ
Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00220  Arginine biosynthesis
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01130  Biosynthesis of antibiotics
amn01210  2-Oxocarboxylic acid metabolism
amn01230  Biosynthesis of amino acids
Module
amn_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    RAM_30985 (argJ)
Enzymes [BR:amn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     RAM_30985 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     RAM_30985 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AEK44672
UniProt: G0FYJ7
LinkDB All DBs
Position
complement(6696774..6697934)
Genome map
AA seq 386 aa AA seqDB search
MTVTGPQGFRAAGVAAGIKASGALDLTLVVNDGPLDIAAGVFTRNVIKAAPVLWSQEVLK
QQRLKAVVLNSGGANAATGPGGFQDTHATAEKVAEVLQAGAIEVAVCSTGLIGERLPMDA
VLSGVDTAFKALGTGAEAGLNAAKGVMTTDTKPKQAFAEHDSGWRVGGFAKGAGMLAPNL
ATMLSVLTTDAVVDKEILDRALRAATHVTFDRLDVDGGTSTNDTVLVLASGASGVEPTEA
ELTELLTAVSHDLVLQLRADSEGATKDVDVTVRGAATEADAIAVARTIAEDNLVKTALFG
SDPNWGRIAMALGRVPARIEPEAVSIAINGVTLFAQGVPAADRSEADLTGRAVEIVVDLG
VGASTATIYTTDLSHGYVEENSAYSS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcaccggcccccagggcttccgcgccgccggcgtcgccgccgggatcaaggcc
tccggcgcgctcgacctcaccctggtcgtcaacgacggcccgctggacatcgcggcgggc
gtgttcacccgcaacgtcatcaaggccgcgccggtgctgtggtcgcaggaagtgctcaag
cagcagcggctgaaggccgtcgtcctcaactcgggcggggccaacgcggccaccgggccc
ggcggcttccaggacacccacgcaacggccgagaaggtcgccgaagtcctgcaggccggc
gccatcgaggtcgccgtctgctccaccggcctgatcggcgaacggctcccgatggacgcg
gtcctgtccggagtggacaccgccttcaaagccctcggcaccggcgccgaagcgggcctc
aacgccgccaagggcgtgatgaccaccgacaccaaaccgaagcaggccttcgccgagcac
gacagcggctggcgcgtcggcggcttcgccaagggtgcgggcatgctcgcgccgaacctc
gccaccatgctctcggtcctgaccaccgacgccgtggtggacaaggaaatcctcgaccgg
gccctgcgcgcggccacccacgtcaccttcgaccggctcgacgtcgacggcggcacgtcc
accaacgacaccgtcctggtcctggcgtccggcgcgagcggggtcgaaccgaccgaagcg
gagctgaccgagctgctcaccgcggtcagccacgacctggtgctccagctgcgcgcggac
tccgagggcgcgaccaaggacgtcgacgtcaccgtgcggggtgcggccaccgaggccgac
gcgatcgccgtcgcccgcacgatcgccgaggacaacctggtcaagacggcactgttcggc
tccgacccgaactggggccggatcgccatggcgctcggccgggtgccggcccgcatcgaa
ccggaagccgtgtcgatcgcgatcaacggcgtcaccctgttcgcccagggtgtgcccgcc
gccgaccggtccgaggcggacctcaccggccgggccgtcgagatcgtcgtcgacctcggc
gtcggcgcgagcaccgcgaccatctacaccacggatctttcgcacggttacgtcgaagag
aacagcgcgtactcctcatga

DBGET integrated database retrieval system